LXL04_021741 | RubberDandelionOmics

Gene overview

LXL04_021741

Reference: OH-1004 Chr: Chr04 Coordinates: 136098819-136102414 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3231 bp · LXL04_021741|LXL04_021741|OH1004|cDNA

ATGAATGAAAGAAAAGCATGTGTGTATAAGGCAAAGAGAGCGTGGGGTTTATGTTTTCTTTCTTCACACCAAACAAACCCCACTGAACACAACAATCATCATGAAACATCCTCTGCTGCACCCACCACTCCTAAAAAGCAACAATCCCAATCCCTTCCCTTAAATTTACTACCTTTTCTTACTCAAATCCACCATCACACTCTCCTCTCAACAGCCATGGACCACCGTCCTCCGCCGTGTCTCcctctcctcctcctcct...

CDS

Download CDS FASTA

3231 bp · LXL04_021741|LXL04_021741|OH1004|CDS

ATGAATGAAAGAAAAGCATGTGTGTATAAGGCAAAGAGAGCGTGGGGTTTATGTTTTCTTTCTTCACACCAAACAAACCCCACTGAACACAACAATCATCATGAAACATCCTCTGCTGCACCCACCACTCCTAAAAAGCAACAATCCCAATCCCTTCCCTTAAATTTACTACCTTTTCTTACTCAAATCCACCATCACACTCTCCTCTCAACAGCCATGGACCACCGTCCTCCGCCGTGTCTCCCTCTCCTCCTCCTCCT...

Protein

Download Protein FASTA

1076 aa · LXL04_021741|LXL04_021741|OH1004|PROTEIN

MNERKACVYKAKRAWGLCFLSSHQTNPTEHNNHHETSSAAPTTPKKQQSQSLPLNLLPFLTQIHHHTLLSTAMDHRPPPCLPLLLLLFFFSSAAALPSEFLSLLALKSSLKDPLGTLHDWDPLKPGTQCSWSGVKCDLKSDLVDSLDISNRNLSGRIPPEIRYLTGLRHLNISVNQFAGPFPTVIFDLSFLQTLDVNHNLFSSVFPEGISKLKRLMFFDAYSNSFTGPLPTEFVGLRFLEHLNLGGSYFEGEIPESYGRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021741`
TK1151 ID	TkA05G417950
OH-1004 ID	LXL04_021741
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 51.399 / OH-1004 18.773 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021741

Location Chr04:136098819-136102414 (-)

Description Similar to TDR: Leucine-rich repeat receptor-like protein kinase TDR

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61480`	Acts with CLE41p and CLE44p peptides as a ligand-receptor pair in a signal transduction pathway involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	No verified direct reference in this release
`At4g28650`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
`At1g08590`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	No verified direct reference in this release
`At3g49670`	LRR-rich receptor-like kinase (LRR-RLK) implicated in the detection of the CLAVATA-family peptides (CLEs), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36.	No verified direct reference in this release
`At5g65700`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to CLV1 and BAM3, participates in the detection of the CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021741 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G08590

ath:AT3G49670

ath:AT4G28650

ath:AT5G61480

ath:AT5G65700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.881

Rank 1 · LXL04_021741 · OH-1004

Endoplasmic reticulum0.084

Rank 2 · LXL04_021741 · OH-1004

Cytoplasm0.062

Rank 3 · LXL04_021741 · OH-1004

Nucleus0.046

Rank 4 · LXL04_021741 · OH-1004

Lysosome / Vacuole0.021

Rank 5 · LXL04_021741 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_297-137 aa

PF23598.2LRR_14160-244 aa

PF13855.13LRR_8191-246 aa

PF23598.2LRR_14228-292 aa

PF23598.2LRR_14258-341 aa

PF23598.2LRR_14300-389 aa

PF12799.14LRR_4333-373 aa

PF13855.13LRR_8334-393 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021741	`PF08263.18`	LRRNT_2	97	137	1.1e-08	35.9
LXL04_021741	`PF23598.2`	LRR_14	160	244	1.6e-36	126.5
LXL04_021741	`PF13855.13`	LRR_8	191	246	2.3e-34	117.7
LXL04_021741	`PF23598.2`	LRR_14	228	292	1.6e-36	126.5
LXL04_021741	`PF23598.2`	LRR_14	258	341	1.6e-36	126.5
LXL04_021741	`PF23598.2`	LRR_14	300	389	1.6e-36	126.5
LXL04_021741	`PF12799.14`	LRR_4	333	373	3.6e-32	110.3
LXL04_021741	`PF13855.13`	LRR_8	334	393	2.3e-34	117.7
LXL04_021741	`PF23598.2`	LRR_14	346	509	1.6e-36	126.5
LXL04_021741	`PF12799.14`	LRR_4	358	394	3.6e-32	110.3
LXL04_021741	`PF23598.2`	LRR_14	400	585	1.6e-36	126.5
LXL04_021741	`PF13855.13`	LRR_8	407	465	2.3e-34	117.7
LXL04_021741	`PF13855.13`	LRR_8	478	536	2.3e-34	117.7
LXL04_021741	`PF13855.13`	LRR_8	595	632	2.3e-34	117.7
LXL04_021741	`PF13855.13`	LRR_8	620	658	2.3e-34	117.7
LXL04_021741	`PF00069.32`	Pkinase	773	1043	3.1e-45	155.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FII5`	Arabidopsis thaliana	Leucine-rich repeat receptor-like protein kinase TDR	61.380%	Swiss-Prot	strong database homology
`Q9M0G7`	Arabidopsis thaliana	MDIS1-interacting receptor like kinase 1	44.153%	Swiss-Prot	moderate database homology
`Q9FRS6`	Arabidopsis thaliana	Leucine-rich repeat receptor-like protein kinase PXL1	42.110%	Swiss-Prot	moderate database homology
`Q9M2Z1`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2	42.901%	Swiss-Prot	moderate database homology
`O49545`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	43.139%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card