Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3162 bp · TkA05G417950|TK1151|cDNA
TCTTCACACCAAACAAACCCCACTGAACACAACAATCATCATGAAACATCCTCTGCTGCACCCACCACTCCTAAAAAGCAACAATCCCAATCCCTTCCCTTAAATTTACTACCTTTTCTTACTCAAATCCACCATCACACTCTCCTCTCAACAGCCATGGACCACCGTCCTCCGCCGTGTCTCCCTCTCCTCCTCCTCCTCTTCTTCTTCTCTTCCGCCGCTGCTCTTCCTTCAGAGTTTCTTTCTCTTCTCGCACTAAA...
1182 bp · TkA05G417950|TK1151|CDS
TCTTCACACCAAACAAACCCCACTGAACACAACAATCATCATGAAACATCCTCTGCTGCACCCACCACTCCTAAAAAGCAACAATCCCAATCCCTTCCCTTAAATTTACTACCTTTTCTTACTCAAATCCACCATCACACTCTCCTCTCAACAGCCATGGACCACCGTCCTCCGCCGTGTCTCCCTCTCCTCCTCCTCCTCTTCTTCTTCTCTTCCGCCGCTGCTCTTCCTTCAGAGTTTCTTTCTCTTCTCGCACTAAA...
Protein
Download Protein FASTA393 aa · TkA05G417950|TK1151|PROTEIN
SSHQTNPTEHNNHHETSSAAPTTPKKQQSQSLPLNLLPFLTQIHHHTLLSTAMDHRPPPCLPLLLLLFFFSSAAALPSEFLSLLALKSSLKDPLGTLHDWDPLKPGTQCSWSGVKCDLKSDLVDSLDISNRNLSGRIPPEIRYLTGLRHLNISVNQFAGPFPTVIFDLSFLQTLDVNHNLFSSVFPEGISKLKRLMFFDAYSNSFTGPLPTEFVGLRFLEHLNLGGSYFEGEIPESYGRFQMLKFLHLAGNDLRGEIPAE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G417950 |
|---|---|
| TK1151 ID | TkA05G417950 |
| OH-1004 ID | LXL04_021741 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 99.000 |
| Protein coverage (%) | TK1151 51.399 / OH-1004 18.773Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G417950 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:104057837-104061359 (-) | |||||||||
| Description | Similar to TDR: Leucine-rich repeat receptor-like protein kinase TDR | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006468 protein phosphorylation Biological Process GO:0009755 hormone-mediated signaling pathway Biological Process GO:0009934 regulation of meristem structural organization Biological Process GO:0010067 procambium histogenesis Biological Process GO:0010075 regulation of meristem growth Biological Process GO:0010087 phloem or xylem histogenesis Biological Process GO:0010089 xylem development Biological Process GO:0010183 pollen tube guidance Biological Process GO:0010223 secondary shoot formation Biological Process GO:0030154 cell differentiation Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0046777 protein autophosphorylation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G08590 ath:AT3G49670 ath:AT4G28650 ath:AT5G61480 ath:AT5G65700 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08263LRRNT_277-117 aaPF24758LRR_At5g56370122-178 aaPF25013LRR_Zer-1124-136 aaPF00560LRR_1125-144 aaPF12799LRR_4125-156 aaPF13855LRR_8125-156 aaPF23211LRR_LRWD1125-183 aaPF23598LRR_14140-224 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G417950 | PF08263 | LRRNT_2 | 77 | 117 | 3e-09 | 37.7 |
| TkA05G417950 | PF24758 | LRR_At5g56370 | 122 | 178 | 0.00016 | 22.1 |
| TkA05G417950 | PF25013 | LRR_Zer-1 | 124 | 136 | 2e-05 | 25.5 |
| TkA05G417950 | PF00560 | LRR_1 | 125 | 144 | 3.6e-31 | 101.2 |
| TkA05G417950 | PF12799 | LRR_4 | 125 | 156 | 2.8e-22 | 78.9 |
| TkA05G417950 | PF13855 | LRR_8 | 125 | 156 | 1e-17 | 64.3 |
| TkA05G417950 | PF23211 | LRR_LRWD1 | 125 | 183 | 0.0026 | 18.2 |
| TkA05G417950 | PF23598 | LRR_14 | 140 | 224 | 1.7e-27 | 96.8 |
| TkA05G417950 | PF25013 | LRR_Zer-1 | 140 | 156 | 2e-05 | 25.5 |
| TkA05G417950 | PF13855 | LRR_8 | 146 | 203 | 1e-17 | 64.3 |
| TkA05G417950 | PF00560 | LRR_1 | 147 | 166 | 3.6e-31 | 101.2 |
| TkA05G417950 | PF13516 | LRR_6 | 147 | 157 | 3.7e-05 | 24.2 |
| TkA05G417950 | PF24141 | LRR_ComC | 162 | 258 | 3e-05 | 24.6 |
| TkA05G417950 | PF25013 | LRR_Zer-1 | 165 | 187 | 2e-05 | 25.5 |
| TkA05G417950 | PF13516 | LRR_6 | 169 | 179 | 3.7e-05 | 24.2 |
| TkA05G417950 | PF00560 | LRR_1 | 171 | 192 | 3.6e-31 | 101.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.