LXL04_021348 | RubberDandelionOmics

Gene overview

LXL04_021348

Reference: OH-1004 Chr: Chr04 Coordinates: 127782493-127788210 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3483 bp · LXL04_021348|LXL04_021348|OH1004|cDNA

ATGGCGACGCCATTGACCGGATTGCAACACCGGGACGTTGGAGGTGGTGGTGTGGCTGTGATGGCGGCTTCCGGAGGAGGGGCGGTCAACCAGATGGATCCGTCCAGTAGTAACAAATCATCCAAAAAACAAAGTTCTCCAATTCATATCTTCTTAATCTTTCATAAAGCCATTCGGTCGGAGCTCGATGCCCTACACCGGTCTGCCATTGCTTTTGCTACTAATACTCATGTGGAAATTGAGCCTTTGCTCAAGCGCTA...

CDS

Download CDS FASTA

3483 bp · LXL04_021348|LXL04_021348|OH1004|CDS

ATGGCGACGCCATTGACCGGATTGCAACACCGGGACGTTGGAGGTGGTGGTGTGGCTGTGATGGCGGCTTCCGGAGGAGGGGCGGTCAACCAGATGGATCCGTCCAGTAGTAACAAATCATCCAAAAAACAAAGTTCTCCAATTCATATCTTCTTAATCTTTCATAAAGCCATTCGGTCGGAGCTCGATGCCCTACACCGGTCTGCCATTGCTTTTGCTACTAATACTCATGTGGAAATTGAGCCTTTGCTCAAGCGCTA...

Protein

Download Protein FASTA

1160 aa · LXL04_021348|LXL04_021348|OH1004|PROTEIN

MATPLTGLQHRDVGGGGVAVMAASGGGAVNQMDPSSSNKSSKKQSSPIHIFLIFHKAIRSELDALHRSAIAFATNTHVEIEPLLKRYHFLRSIYKHHCNAEDEVIFPALDIRVKNVARTYSLEHEGESVIFDQLFTLLDSDMQNEESFRRELASCTGALQTSISQHMSKEEEQVFPLLVEKFSFEEQASLVWQFLCSIPVNMMAEFLPWLSASVSSDERHEMRNCLCKVIPDEKLLQQIIFTWMDGSHGVKKRKNSEECE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021348`
TK1151 ID	TkA05G381940
OH-1004 ID	LXL04_021348
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021348

Location Chr04:127782493-127788210 (+)

Description Similar to BTS: Zinc finger protein BRUTUS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18290`	Essential protein.	No verified direct reference in this release
`At1g74770`	Probable E3 ubiquitin-protein ligase that may regulate the response to iron deficiency and thus contributes to iron homeostasis.	No verified direct reference in this release
`At1g18910`	Probable E3 ubiquitin-protein ligase that may regulate the response to iron deficiency and thus contributes to iron homeostasis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021348 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0010039 response to iron ion Biological Process

GO:0010106 cellular response to iron ion starvation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0033212 iron import into cell Biological Process

GO:0034756 regulation of iron ion transport Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0071282 cellular response to iron(II) ion Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0098711 iron ion import across plasma membrane Biological Process

KEGG gene cross-reference

ath:AT1G18910

ath:AT1G74770

ath:AT3G18290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.520

Rank 1 · LXL04_021348 · OH-1004

Nucleus0.366

Rank 2 · LXL04_021348 · OH-1004

Cell membrane0.208

Rank 3 · LXL04_021348 · OH-1004

Golgi apparatus0.086

Rank 4 · LXL04_021348 · OH-1004

Lysosome / Vacuole0.069

Rank 5 · LXL04_021348 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01814.29Hemerythrin47-178 aa

PF01814.29Hemerythrin285-417 aa

PF01814.29Hemerythrin587-732 aa

PF05495.18zf-CHY914-982 aa

PF13639.13zf-RING_21042-1084 aa

PF14599.12zinc_ribbon_61090-1147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021348	`PF01814.29`	Hemerythrin	47	178	8.3e-26	91.6
LXL04_021348	`PF01814.29`	Hemerythrin	285	417	8.3e-26	91.6
LXL04_021348	`PF01814.29`	Hemerythrin	587	732	8.3e-26	91.6
LXL04_021348	`PF05495.18`	zf-CHY	914	982	1.8e-18	67.4
LXL04_021348	`PF13639.13`	zf-RING_2	1042	1084	1.2e-06	29.4
LXL04_021348	`PF14599.12`	zinc_ribbon_6	1090	1147	4.3e-24	84.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPQ5`	Arabidopsis thaliana	Zinc finger protein BRUTUS	62.291%	Swiss-Prot	strong database homology
`F4HVS0`	Arabidopsis thaliana	Zinc finger protein BRUTUS-like At1g74770	56.932%	Swiss-Prot	weak database homology
`F4IDY5`	Arabidopsis thaliana	Zinc finger protein BRUTUS-like At1g18910	55.587%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card