LXL04_019587 | RubberDandelionOmics

Gene overview

LXL04_019587

Reference: OH-1004 Chr: Chr04 Coordinates: 34621405-34623075 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

510 bp · LXL04_019587|LXL04_019587|OH1004|cDNA

ATGGCGAACATTCGGGTTCTCAAAGAGTGGTTCGACCGAGTTGACTCAGAAAAAACAGGGAGCATCACAACAGTTCAACTCCAGAGTGCTCTTGCTGTTGGAAATCTACAATTTCCCATCACAGTTGTTCAACAAATGATCAGGATGTATGATTTCGACAGGAATGgaactatgagttttgaagAGTTTGTGGCTCTTAACAAGTTTCTCTTAAAGGTTCAACAAGCTTTTTCGGACTTCGAGAGGGGTCGTGGATTTCT...

CDS

Download CDS FASTA

510 bp · LXL04_019587|LXL04_019587|OH1004|CDS

ATGGCGAACATTCGGGTTCTCAAAGAGTGGTTCGACCGAGTTGACTCAGAAAAAACAGGGAGCATCACAACAGTTCAACTCCAGAGTGCTCTTGCTGTTGGAAATCTACAATTTCCCATCACAGTTGTTCAACAAATGATCAGGATGTATGATTTCGACAGGAATGGAACTATGAGTTTTGAAGAGTTTGTGGCTCTTAACAAGTTTCTCTTAAAGGTTCAACAAGCTTTTTCGGACTTCGAGAGGGGTCGTGGATTTCT...

Protein

Download Protein FASTA

169 aa · LXL04_019587|LXL04_019587|OH1004|PROTEIN

MANIRVLKEWFDRVDSEKTGSITTVQLQSALAVGNLQFPITVVQQMIRMYDFDRNGTMSFEEFVALNKFLLKVQQAFSDFERGRGFLVADEVYEALLKMDISLDSPAFYTVCESFDKEKNGRFRLDDLMSLCIFVQSARNLFGSFDTSKQGRVTLDLNQFIYCTANCRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019587`
TK1151 ID	TkA05G065530
OH-1004 ID	LXL04_019587
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_019587`
Location	Chr04:34621405-34623075 (+)
Description	Similar to Sorcin
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019587` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0001938 positive regulation of endothelial cell proliferation Biological Process GO:0006886 intracellular protein transport Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0009611 response to wounding Biological Process GO:0009617 response to bacterium Biological Process GO:0010595 positive regulation of endothelial cell migration Biological Process GO:0032007 negative regulation of TOR signaling Biological Process GO:0034605 cellular response to heat Biological Process GO:0048208 COPII vesicle coating Biological Process GO:0051592 response to calcium ion Biological Process GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction Biological Process GO:1902527 positive regulation of protein monoubiquitination Biological Process
KEGG gene cross-reference	ddi:DDB_G0291081 ddi:DDB_G0293530 hsa:10016 mmu:18570 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.623

Rank 1 · LXL04_019587 · OH-1004

Nucleus0.356

Rank 2 · LXL04_019587 · OH-1004

Cell membrane0.105

Rank 3 · LXL04_019587 · OH-1004

Mitochondrion0.096

Rank 4 · LXL04_019587 · OH-1004

Endoplasmic reticulum0.059

Rank 5 · LXL04_019587 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_76-65 aa

PF13833.13EF-hand_819-66 aa

PF00036.39EF-hand_143-66 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019587	`PF13499.13`	EF-hand_7	6	65	2.6e-18	66.8
LXL04_019587	`PF13833.13`	EF-hand_8	19	66	1.3e-07	31.9
LXL04_019587	`PF00036.39`	EF-hand_1	43	66	1.9e-13	49.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card