TkA05G065530 | RubberDandelionOmics

Gene overview

TkA05G065530

Reference: TK1151 Chr: Chr05 Coordinates: 17496066-17497920 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

752 bp · TkA05G065530|TK1151|cDNA

CAAAAATAAGTCGAATTAAAAGGTATGAAACTATGAATGAACTTGGCACCTAAAAACCAGCCATAGAGATCCTCGCAGACGAAGAAAAATGGCGAACATTCGGGTTCTCAAAGAGTGGTTCGACCGAGTTGACTCAGAAAAAACAGGGAGCATCACAACAGTTCAACTCCAGAGTGCTCTTGCTGTTGGAAATCTACAATTTCCCATCACAGTCGTTCAACAAATGATCAGGATGTATGACTTCGACAGGAATGGAACTA...

CDS

Download CDS FASTA

510 bp · TkA05G065530|TK1151|CDS

ATGGCGAACATTCGGGTTCTCAAAGAGTGGTTCGACCGAGTTGACTCAGAAAAAACAGGGAGCATCACAACAGTTCAACTCCAGAGTGCTCTTGCTGTTGGAAATCTACAATTTCCCATCACAGTCGTTCAACAAATGATCAGGATGTATGACTTCGACAGGAATGGAACTATGAGTTTTGAAGAGTTTGTGGCTCTTAACAAGTTTCTCTTAAAGGTTCAACAAGCTTTTTCGGACTTCGAGAGGGGTCGTGGATTTCT...

Protein

Download Protein FASTA

169 aa · TkA05G065530|TK1151|PROTEIN

MANIRVLKEWFDRVDSEKTGSITTVQLQSALAVGNLQFPITVVQQMIRMYDFDRNGTMSFEEFVALNKFLLKVQQAFSDFERGRGFLVADEVYEALLKMDISLDSPAFYTVCESFDKDKNGRFRLDDLMSLCIFVQSARNLFSSFDTSKQGRVTLDLNQFIYCTANCRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G065530`
TK1151 ID	TkA05G065530
OH-1004 ID	LXL04_019587
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G065530

Location Chr05:17496066-17497920 (+)

Description Similar to Sorcin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0126400`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019587 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001938 positive regulation of endothelial cell proliferation Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0010595 positive regulation of endothelial cell migration Biological Process

GO:0032007 negative regulation of TOR signaling Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0048208 COPII vesicle coating Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction Biological Process

GO:1902527 positive regulation of protein monoubiquitination Biological Process

KEGG gene cross-reference

ddi:DDB_G0291081

ddi:DDB_G0293530

hsa:10016

mmu:18570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.620

Rank 1 · TkA05G065530 · TK1151

Nucleus0.346

Rank 2 · TkA05G065530 · TK1151

Cell membrane0.107

Rank 3 · TkA05G065530 · TK1151

Mitochondrion0.097

Rank 4 · TkA05G065530 · TK1151

Endoplasmic reticulum0.058

Rank 5 · TkA05G065530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25825SAPC2_N4-75 aa

PF30624EF_SSP1205-24 aa

PF13499EF-hand_76-65 aa

PF13405EF-hand_67-32 aa

PF00036EF-hand_17-31 aa

PF13202EF-hand_57-16 aa

PF14658EF-hand_910-65 aa

PF24548EF_EFCAB10_C10-31 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G065530	`PF25825`	SAPC2_N	4	75	2.7e-06	27.9
TkA05G065530	`PF30624`	EF_SSP120	5	24	0.23	12.9
TkA05G065530	`PF13499`	EF-hand_7	6	65	2.3e-19	70.2
TkA05G065530	`PF13405`	EF-hand_6	7	32	4.2e-17	60.9
TkA05G065530	`PF00036`	EF-hand_1	7	31	2.4e-15	55.6
TkA05G065530	`PF13202`	EF-hand_5	7	16	0.017	15.3
TkA05G065530	`PF14658`	EF-hand_9	10	65	2.1e-05	25.6
TkA05G065530	`PF24548`	EF_EFCAB10_C	10	31	0.017	15.5
TkA05G065530	`PF12763`	EH	12	73	0.11	13.2
TkA05G065530	`PF13833`	EF-hand_8	19	66	2.1e-08	34.5
TkA05G065530	`PF30624`	EF_SSP120	41	64	0.23	12.9
TkA05G065530	`PF00036`	EF-hand_1	43	66	2.4e-15	55.6
TkA05G065530	`PF23564`	EF-hand_FSTL1	43	65	0.035	15.2
TkA05G065530	`PF24548`	EF_EFCAB10_C	44	63	0.017	15.5
TkA05G065530	`PF13202`	EF-hand_5	44	65	0.017	15.3
TkA05G065530	`PF13405`	EF-hand_6	45	66	4.2e-17	60.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6Z2M9`	Oryza sativa subsp. japonica	sp\|Q6Z2M9\|CDPK4_ORYSJ Calcium-dependent protein kinase 4	31.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card