LXL04_019474 | RubberDandelionOmics

Gene overview

LXL04_019474

Reference: OH-1004 Chr: Chr04 Coordinates: 32212347-32216315 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1395 bp · LXL04_019474|LXL04_019474|OH1004|cDNA

ATGGATAGGATGTTTTCAGTGGACGATATCGCGGGCCACTTTTGGTCGCCATCGCCGGCCGCCGGCGCAGCCGACGAGGATGAATCGTCGTCTTCTTCATCCGCATCTAAGAGCAAGTCAACGCCGGCGATGATGAATCGGAGCATGTCGGAGTGGCAATTTCAACGCTTCCTCCAAGAAGCATCGGCACCACCGGAATCTACCTCCTATAGACCAAACGAAGTTGTCGAGATCAAGGATCAAGATGAGCTTCGAGAAAA...

CDS

Download CDS FASTA

1395 bp · LXL04_019474|LXL04_019474|OH1004|CDS

ATGGATAGGATGTTTTCAGTGGACGATATCGCGGGCCACTTTTGGTCGCCATCGCCGGCCGCCGGCGCAGCCGACGAGGATGAATCGTCGTCTTCTTCATCCGCATCTAAGAGCAAGTCAACGCCGGCGATGATGAATCGGAGCATGTCGGAGTGGCAATTTCAACGCTTCCTCCAAGAAGCATCGGCACCACCGGAATCTACCTCCTATAGACCAAACGAAGTTGTCGAGATCAAGGATCAAGATGAGCTTCGAGAAAA...

Protein

Download Protein FASTA

464 aa · LXL04_019474|LXL04_019474|OH1004|PROTEIN

MDRMFSVDDIAGHFWSPSPAAGAADEDESSSSSSASKSKSTPAMMNRSMSEWQFQRFLQEASAPPESTSYRPNEVVEIKDQDELREKNQPSATTTATLKNNESGRTTGSSTGGGAAATTSFGASIAGGPPNVPIDSEEYQAYLKSRLNLACAAVALTRASSAKAQDFAGLTDNGSQASNTSQLGYQVPSKGFDPKGASKDGGGPIGIPSLPAVQKKVAAIPVKSATSGSSRELSDDDELDGDTETTQNMDPTDAKRVRRM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019474`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019474

Location Chr04:32212347-32216315 (+)

Description Similar to CPRF2: Light-inducible protein CPRF2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28770`	Transcription factor involved in controlling responses to starvation.	SnRK1-triggered switch of bZIP63 dimerization mediates the low-energy response in plants.2015 · DOI: 10.7554/elife.05828
`At4g02640`	Transcription factor that binds to the C-box-like motif (5'-TGCTGACGTCA-3') and G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of gene promoters.	Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2.2003 · DOI: 10.1074/jbc.m210538200 Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.2006 · DOI: 10.1038/sj.emboj.7601206 bZIP10-LSD1 antagonism modulates basal defense and cell death in Arabidopsis following infection.2006 · DOI: 10.1038/sj.emboj.7601312 A nuclear gene encoding the iron-sulfur subunit of mitochondrial complex II is regulated by B3 domain transcription factors during seed development in Arabidopsis.2009 · DOI: 10.1104/pp.109.136531 A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968
`At3g54620`	Transcription factor that binds to the 5'-ACGT-3' box, especially present in G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of seed storage protein (SSP) encoding gene promoters (e.g.	Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2.2003 · DOI: 10.1074/jbc.m210538200 A nuclear gene encoding the iron-sulfur subunit of mitochondrial complex II is regulated by B3 domain transcription factors during seed development in Arabidopsis.2009 · DOI: 10.1104/pp.109.136531 A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0796900`	Transcriptional activator that binds to the DNA specific sequence 5'-GCCACGT[AC]AG-3' found in the alpha-globulin gene promoter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019474 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002240 response to molecule of oomycetes origin Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009267 cellular response to starvation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009649 entrainment of circadian clock Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071333 cellular response to glucose stimulus Biological Process

GO:2000693 positive regulation of seed maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT3G54620

ath:AT4G02640

ath:AT5G28770

dosa:Os03g0796900

osa:4334424

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · LXL04_019474 · OH-1004

Cytoplasm0.089

Rank 2 · LXL04_019474 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_019474 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_019474 · OH-1004

Plastid0.011

Rank 5 · LXL04_019474 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07716.21bZIP_2252-301 aa

PF00170.27bZIP_1254-306 aa

PF12498.14bZIP_C322-449 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019474	`PF07716.21`	bZIP_2	252	301	2.9e-08	34.3
LXL04_019474	`PF00170.27`	bZIP_1	254	306	6.5e-14	52.5
LXL04_019474	`PF12498.14`	bZIP_C	322	449	1.3e-33	117.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DGI8`	Arabidopsis thaliana	Basic leucine zipper 63	40.089%	Swiss-Prot	moderate database homology
`O22763`	Arabidopsis thaliana	Basic leucine zipper 10	39.429%	Swiss-Prot	moderate database homology
`Q9M1G6`	Arabidopsis thaliana	Basic leucine zipper 25	38.162%	Swiss-Prot	moderate database homology
`Q7X9A8`	Oryza sativa subsp. japonica	bZIP transcription factor RISBZ2	46.296%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card