LXL04_018309 | RubberDandelionOmics

Gene overview

LXL04_018309

Reference: OH-1004 Chr: Chr04 Coordinates: 11246556-11248243 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1275 bp · LXL04_018309|LXL04_018309|OH1004|cDNA

ATGGTGGCTACAGCTGCAACTGCATCACTGTTTCCTGTTTCTTCCCCACAACCTAATGGAGCAAAATCATCTGGCAACCTCAGAGGCGTACCAGATAGTGTCGATGTGCGTAAAATCAAGACAAAATCTGTAACTTCAGGGGGTAATATGCAAGTAAAAGCTAATGCACAGGCACCCACAGAGGTAAACGGTACTAGAGTTAGACTCATGAATGGCAGCATCAAAACCGATGATAGTAATCTCACATCACATGCCCCAAG...

CDS

Download CDS FASTA

1275 bp · LXL04_018309|LXL04_018309|OH1004|CDS

ATGGTGGCTACAGCTGCAACTGCATCACTGTTTCCTGTTTCTTCCCCACAACCTAATGGAGCAAAATCATCTGGCAACCTCAGAGGCGTACCAGATAGTGTCGATGTGCGTAAAATCAAGACAAAATCTGTAACTTCAGGGGGTAATATGCAAGTAAAAGCTAATGCACAGGCACCCACAGAGGTAAACGGTACTAGAGTTAGACTCATGAATGGCAGCATCAAAACCGATGATAGTAATCTCACATCACATGCCCCAAG...

Protein

Download Protein FASTA

424 aa · LXL04_018309|LXL04_018309|OH1004|PROTEIN

MVATAATASLFPVSSPQPNGAKSSGNLRGVPDSVDVRKIKTKSVTSGGNMQVKANAQAPTEVNGTRVRLMNGSIKTDDSNLTSHAPRTFINQLPDWSMLLAAITTIFLAAEKQWMMLEWKTKRPDMLSDLDPFGLGRIVQDGLVFRQNFSIRSYEIGADRTASIETLMNHFQETALNHVKTAGLLGDGFGSTPEMCKKNLFWVVTKMQVMVDRYPTWGDVVQVDTWVAPSGKNGMRRDWLLRDYKTGEILTRASSNWVMM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018309`
TK1151 ID	TkA08G006660
OH-1004 ID	LXL04_018309
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.382 / OH-1004 39.623 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018309

Location Chr04:11246556-11248243 (-)

Description Similar to FATB1: Palmitoyl-acyl carrier protein thioesterase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08510`	Plays an essential role in chain termination during de novo fatty acid synthesis.	Accumulation of palmitate in Arabidopsis mediated by the acyl-acyl carrier protein thioesterase FATB1.2000 · DOI: 10.1104/pp.123.2.637 Characterization of substrate specificity of plant FatA and FatB acyl-ACP thioesterases.2002 · DOI: 10.1016/s0003-9861(02)00017-6 Disruption of the FATB gene in Arabidopsis demonstrates an essential role of saturated fatty acids in plant growth.2003 · DOI: 10.1105/tpc.008946 A structural model of the plant acyl-acyl carrier protein thioesterase FatB comprises two helix/4-stranded sheet domains, the N-terminal domain containing residues that affect specificity and the C-terminal domain containing catalytic residues.2005 · DOI: 10.1074/jbc.m411351200 A MYB transcription factor regulates very-long-chain fatty acid biosynthesis for activation of the hypersensitive cell death response in Arabidopsis.2008 · DOI: 10.1105/tpc.107.054858

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018309 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0000036 acyl carrier activity Molecular Function

GO:0016297 fatty acyl-[ACP] hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G08510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.935

Rank 1 · LXL04_018309 · OH-1004

Mitochondrion0.073

Rank 2 · LXL04_018309 · OH-1004

Cytoplasm0.030

Rank 3 · LXL04_018309 · OH-1004

Nucleus0.027

Rank 4 · LXL04_018309 · OH-1004

Peroxisome0.023

Rank 5 · LXL04_018309 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12590.14Acyl-thio_N1-129 aa

PF01643.24Acyl-ACP_TE142-278 aa

PF20791.4Acyl-ACP_TE_C303-407 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018309	`PF12590.14`	Acyl-thio_N	1	129	1.6e-49	168.5
LXL04_018309	`PF01643.24`	Acyl-ACP_TE	142	278	4.8e-42	143.5
LXL04_018309	`PF20791.4`	Acyl-ACP_TE_C	303	407	3.3e-26	92.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJE2`	Arabidopsis thaliana	Palmitoyl-acyl carrier protein thioesterase, chloroplastic	66.429%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card