LXL04_016968 | RubberDandelionOmics

Gene overview

LXL04_016968

Reference: OH-1004 Chr: Chr03 Coordinates: 138085511-138086926 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

930 bp · LXL04_016968|LXL04_016968|OH1004|cDNA

ATGTCTTGCGAAATAGGAGAAACCGTGGAGGTCATCGGCATTGAAGATGGAATGGAGGGGTCCTACTTTAGGGCCCAGGTGATTGACCGCTCACCTGGGAGGAGAACAGTCAGGTATCAGACTCTGCTTGCTGATGATGGATCACCTCTGGAAGAGGTCATCAGCGTTAGGAGACTTCGACCCCCTCCTCCCACTGTCGTGGCGCGATTTCATCTTGGTGACATGGTGGATGCTTGGCACAATGACGGCTGGTGGGTAGG...

CDS

Download CDS FASTA

930 bp · LXL04_016968|LXL04_016968|OH1004|CDS

ATGTCTTGCGAAATAGGAGAAACCGTGGAGGTCATCGGCATTGAAGATGGAATGGAGGGGTCCTACTTTAGGGCCCAGGTGATTGACCGCTCACCTGGGAGGAGAACAGTCAGGTATCAGACTCTGCTTGCTGATGATGGATCACCTCTGGAAGAGGTCATCAGCGTTAGGAGACTTCGACCCCCTCCTCCCACTGTCGTGGCGCGATTTCATCTTGGTGACATGGTGGATGCTTGGCACAATGACGGCTGGTGGGTAGG...

Protein

Download Protein FASTA

309 aa · LXL04_016968|LXL04_016968|OH1004|PROTEIN

MSCEIGETVEVIGIEDGMEGSYFRAQVIDRSPGRRTVRYQTLLADDGSPLEEVISVRRLRPPPPTVVARFHLGDMVDAWHNDGWWVGSTIACSSRVEGIGGRRKVEVSQEIEWKESSWWKLVQLVFFSLFWWLNRASMVEVSSACFLQLVQLVFFSLFSSACFRGCLIGKGCFGSVYVANLKKPKSRYSSFPPILAVKSAEVSVSSSIQKEKEVLNNLRGCRNVIRCFGEEITTGENGQMVYNLLLQYGSGRTLADLINK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016968`
TK1151 ID	TkA03G184020
OH-1004 ID	LXL04_016968
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	83.500
Protein coverage (%)	TK1151 67.763 / OH-1004 33.010 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016968

Location Chr03:138085511-138086926 (+)

Description Similar to MAPKKK20: Mitogen-activated protein kinase kinase kinase 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50310`	Mitogen-activated protein kinase kinase (MAPKK) that phosphorylates both MKK3 and MPK18 and regulate two separate signaling pathways involved in root microtubule functions.	Arabidopsis MKKK20 is involved in osmotic stress response via regulation of MPK6 activity.2012 · DOI: 10.1007/s00299-011-1157-0 AIK1, A Mitogen-Activated Protein Kinase, Modulates Abscisic Acid Responses through the MKK5-MPK6 Kinase Cascade.2017 · DOI: 10.1104/pp.16.01386 The Arabidopsis Mitogen-Activated Protein Kinase Kinase Kinase 20 (MKKK20) Acts Upstream of MKK3 and MPK18 in Two Separate Signaling Pathways Involved in Root Microtubule Functions.2017 · DOI: 10.3389/fpls.2017.01352
`At1g26540`	May be involved in the polar growth of plant cells via transportation of RNAs.	Characterization of DUF724 gene family in Arabidopsis thaliana.2010 · DOI: 10.1007/s11103-009-9551-5
`At1g09320`	Heterochromatin-binding protein that preferentially occupies long transposons and specifically recognizes the histone H3 'Lys-9' methylation (H3K9me) marks, with a stronger affinity for dimethylated H3K9 (H3K9me2).	Arabidopsis AGDP1 links H3K9me2 to DNA methylation in heterochromatin.2018 · DOI: 10.1038/s41467-018-06965-w Plant HP1 protein ADCP1 links multivalent H3K9 methylation readout to heterochromatin formation.2019 · DOI: 10.1038/s41422-018-0104-9
`At2g32510`	Component of the abscisic acid (ABA) signaling pathway that may act as ABA signal transducer in the context of abiotic stresses.	No verified direct reference in this release
`At1g11420`	May be involved in the polar growth of plant cells via transportation of RNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016968 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G09320

ath:AT1G26540

ath:AT3G50310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.602

Rank 1 · LXL04_016968 · OH-1004

Cytoplasm0.399

Rank 2 · LXL04_016968 · OH-1004

Cell membrane0.071

Rank 3 · LXL04_016968 · OH-1004

Endoplasmic reticulum0.065

Rank 4 · LXL04_016968 · OH-1004

Mitochondrion0.046

Rank 5 · LXL04_016968 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05641.19Agenet6-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016968	`PF05641.19`	Agenet	6	64	8e-13	49.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SND6`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 20	44.144%	Swiss-Prot	weak database homology
`Q9FZD9`	Arabidopsis thaliana	DUF724 domain-containing protein 3	46.739%	Swiss-Prot	weak database homology
`Q500V5`	Arabidopsis thaliana	Protein AGENET DOMAIN (AGD)-CONTAINING P1	43.678%	Swiss-Prot	weak database homology
`O80888`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 17	35.398%	Swiss-Prot	weak database homology
`F4I8W1`	Arabidopsis thaliana	DUF724 domain-containing protein 2	35.789%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card