TkA03G184020 | RubberDandelionOmics

Gene overview

TkA03G184020

Reference: TK1151 Chr: Chr03 Coordinates: 46314548-46316540 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

459 bp · TkA03G184020|TK1151|cDNA

ATGTCTTTCGAAATAGGAGACACCGTGGAGGTCATCGGCATTGAAGATGGAATGGAGGGGTCCTACTTTAGGGCCCAGGTGATAGACCGCTCACCTGGGAGGAGAACAGTCAGGTATCAGACTCTGCTTGCTGATGATGGATCACCTCTGGAAGAGGTCATCAGCGTTAGGAGACTTCGACCCCCTCCTCCCACTGTCCTGGCGCGATTTCATCTTGGTGACATGGTGGATGCTTGGCACAATGACGGCTGGCGGTGGTG...

CDS

Download CDS FASTA

459 bp · TkA03G184020|TK1151|CDS

ATGTCTTTCGAAATAGGAGACACCGTGGAGGTCATCGGCATTGAAGATGGAATGGAGGGGTCCTACTTTAGGGCCCAGGTGATAGACCGCTCACCTGGGAGGAGAACAGTCAGGTATCAGACTCTGCTTGCTGATGATGGATCACCTCTGGAAGAGGTCATCAGCGTTAGGAGACTTCGACCCCCTCCTCCCACTGTCCTGGCGCGATTTCATCTTGGTGACATGGTGGATGCTTGGCACAATGACGGCTGGCGGTGGTG...

Protein

Download Protein FASTA

152 aa · TkA03G184020|TK1151|PROTEIN

MSFEIGDTVEVIGIEDGMEGSYFRAQVIDRSPGRRTVRYQTLLADDGSPLEEVISVRRLRPPPPTVLARFHLGDMVDAWHNDGWRWCAMMDMRSDFCEDFGGKEQRSRGGEEQRRDRNSRWRSREADGGARLLSPATATGTGDGGVVFSVRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G184020`
TK1151 ID	TkA03G184020
OH-1004 ID	LXL04_016968
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	83.500
Protein coverage (%)	TK1151 67.763 / OH-1004 33.010 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G184020

Location Chr03:46314548-46316540 (-)

Description Similar to MAPKKK20: Mitogen-activated protein kinase kinase kinase 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09320`	Heterochromatin-binding protein that preferentially occupies long transposons and specifically recognizes the histone H3 'Lys-9' methylation (H3K9me) marks, with a stronger affinity for dimethylated H3K9 (H3K9me2).	Arabidopsis AGDP1 links H3K9me2 to DNA methylation in heterochromatin.2018 · DOI: 10.1038/s41467-018-06965-w Plant HP1 protein ADCP1 links multivalent H3K9 methylation readout to heterochromatin formation.2019 · DOI: 10.1038/s41422-018-0104-9

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016968 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT1G09320

ath:AT1G26540

ath:AT3G50310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.901

Rank 1 · TkA03G184020 · TK1151

Cytoplasm0.190

Rank 2 · TkA03G184020 · TK1151

Cell membrane0.023

Rank 3 · TkA03G184020 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA03G184020 · TK1151

Mitochondrion0.017

Rank 5 · TkA03G184020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05641Agenet6-64 aa

PF05641Agenet73-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G184020	`PF05641`	Agenet	6	64	2.4e-14	54.3
TkA03G184020	`PF05641`	Agenet	73	85	2.4e-14	54.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q500V5`	Arabidopsis thaliana	sp\|Q500V5\|AGDP1_ARATH Protein AGENET DOMAIN (AGD)-CONTAINING P1	37.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card