LXL04_015036 | RubberDandelionOmics

Gene overview

LXL04_015036

Reference: OH-1004 Chr: Chr03 Coordinates: 62210957-62216090 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1903 bp · LXL04_015036|LXL04_015036|OH1004|cDNA

TTCGCTTTGGAGACTGCAACCATCTCAGTGTCTTCATATCCCCTTAACCTTCGAACCTCCATTCTTCATCTTCACCAATCACCGGAACCACCATTAATCTTCACCTTCACCCAACACAATGATCACTCTTTCAGACTTCTATCATGTCATGACCGCCGTCGTTCCTCTCTACGTCGCCATGATCTTAGCCTACGGCTCCGTCAAATGGTGGAAGATCTTCACTCCCGATCAATGCTCCGGCATCAACCGTTTCGTTGCTC...

CDS

Download CDS FASTA

1785 bp · LXL04_015036|LXL04_015036|OH1004|CDS

ATGATCACTCTTTCAGACTTCTATCATGTCATGACCGCCGTCGTTCCTCTCTACGTCGCCATGATCTTAGCCTACGGCTCCGTCAAATGGTGGAAGATCTTCACTCCCGATCAATGCTCCGGCATCAACCGTTTCGTTGCTCTCTTCGCCGTCCCCCTCCTCTCCTTCCACTTCATCTCCACCAACAACCCTTACAAAATGAACCTCCGCTTCATCGCCGCCGATACCCTCCAGAAACTGGTGGTTCTTGCCGCCCTCGC...

Protein

Download Protein FASTA

594 aa · LXL04_015036|LXL04_015036|OH1004|PROTEIN

MITLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFISTNNPYKMNLRFIAADTLQKLVVLAALAVWSNVSKRGSLEWSITLFSLSTLPNTLVMGIPLLKGMYGGESGSLMVQIVVLQCIIWYTLMLFLFEFRGARLLISEQFPGTAGAIASIQVDSDIMSLDGRQILETEAEIKEDGKLHVTVRKSNASRSDVFSRRSQGFSSTTPRPSNLTNAEIYSLQSSRNPTPRGSSFNHNDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015036`
TK1151 ID	TkA02G373140
OH-1004 ID	LXL04_015036
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015036

Location Chr03:62210957-62216090 (+)

Description Similar to PIN1C: Probable auxin efflux carrier component 1c

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73590`	Acts as a component of the auxin efflux carrier; this activity is enhanced when activated by D6PK-mediated phosphorylation.	No verified direct reference in this release
`At2g01420`	Acts as a component of the auxin efflux carrier.	Differential auxin-transporting activities of PIN-FORMED proteins in Arabidopsis root hair cells.2010 · DOI: 10.1104/pp.110.156505 Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023 Root System Depth in Arabidopsis Is Shaped by EXOCYST70A3 via the Dynamic Modulation of Auxin Transport.2019 · DOI: 10.1016/j.cell.2019.06.021
`At1g70940`	Acts as a component of the auxin efflux carrier.	Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023 Structures and mechanisms of the Arabidopsis auxin transporter PIN3.2022 · DOI: 10.1038/s41586-022-05142-w

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0232300`	May act as a component of the auxin efflux carrier.	No verified direct reference in this release
`Os02g0743400`	Acts as a component of the auxin efflux carrier.	A PIN1 family gene, OsPIN1, involved in auxin-dependent adventitious root emergence and tillering in rice.2005 · DOI: 10.1093/pcp/pci183

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015036 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009606 tropism Biological Process

GO:0009630 gravitropism Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009908 flower development Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010229 inflorescence development Biological Process

KEGG gene cross-reference

ath:AT1G70940

ath:AT1G73590

ath:AT2G01420

dosa:Os02g0743400

dosa:Os06g0232300

osa:4330700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.774

Rank 1 · LXL04_015036 · OH-1004

Endoplasmic reticulum0.095

Rank 2 · LXL04_015036 · OH-1004

Cytoplasm0.072

Rank 3 · LXL04_015036 · OH-1004

Lysosome / Vacuole0.063

Rank 4 · LXL04_015036 · OH-1004

Golgi apparatus0.043

Rank 5 · LXL04_015036 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03547.24Mem_trans9-587 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015036	`PF03547.24`	Mem_trans	9	587	4.4e-128	427.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6B8`	Arabidopsis thaliana	Auxin efflux carrier component 1	71.406%	Swiss-Prot	strong database homology
`Q8RWZ6`	Arabidopsis thaliana	Auxin efflux carrier component 4	65.361%	Swiss-Prot	strong database homology
`Q9S7Z8`	Arabidopsis thaliana	Auxin efflux carrier component 3	63.231%	Swiss-Prot	strong database homology
`Q67UL3`	Oryza sativa subsp. japonica	Probable auxin efflux carrier component 1c	74.878%	Swiss-Prot	strong database homology
`Q5SMQ9`	Oryza sativa subsp. japonica	Auxin efflux carrier component 1a	72.876%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card