LXL04_014705 | RubberDandelionOmics

Gene overview

LXL04_014705

Reference: OH-1004 Chr: Chr03 Coordinates: 55144320-55145351 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

951 bp · LXL04_014705|LXL04_014705|OH1004|cDNA

ATGGGAGATAAGTGTAATAATGTGGAAGACATTACCGCATGGGGTCATATGAAAGACACTATCATGTGGACTCTAAGCCTTATGTTCAATACCAAAGATTCAACCAATATTGCTGAGAAAGGGTGTAGGGCTAATGATTATCTTACTCAAGGGTATGAAGGCTGTGAAAGAGACTCTTTTCTTCTGACCCCATATCTTGCTAAAATCATTAAGTCACTTATTGCAACTGCTAAAAGAACGGACACGTATAATTTGAATCT...

CDS

Download CDS FASTA

951 bp · LXL04_014705|LXL04_014705|OH1004|CDS

ATGGGAGATAAGTGTAATAATGTGGAAGACATTACCGCATGGGGTCATATGAAAGACACTATCATGTGGACTCTAAGCCTTATGTTCAATACCAAAGATTCAACCAATATTGCTGAGAAAGGGTGTAGGGCTAATGATTATCTTACTCAAGGGTATGAAGGCTGTGAAAGAGACTCTTTTCTTCTGACCCCATATCTTGCTAAAATCATTAAGTCACTTATTGCAACTGCTAAAAGAACGGACACGTATAATTTGAATCT...

Protein

Download Protein FASTA

316 aa · LXL04_014705|LXL04_014705|OH1004|PROTEIN

MGDKCNNVEDITAWGHMKDTIMWTLSLMFNTKDSTNIAEKGCRANDYLTQGYEGCERDSFLLTPYLAKIIKSLIATAKRTDTYNLNLQFAAYEAPKEVVRCSNLCEASISQIITKLLTTVMSKLEETFKPPYNNRGSQDLQDLLCGVLYVIIQKLGNKEETKLSIFQAADTLMVLFLQVFASRSSRVQKEAMLAIGALVYTIGPEFEKHMSNIWKYLELGLQNFKDYEVCNTPIGVVRDICRSSDGKMILPYYDNIMKML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014705`
TK1151 ID	TkA02G404200
OH-1004 ID	LXL04_014705
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 62.025 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014705

Location Chr03:55144320-55145351 (-)

Description Similar to KPNB1: Importin subunit beta-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53480`	Acts as a negative effector of drought tolerance.	An Arabidopsis homolog of importin β1 is required for ABA response and drought tolerance.2013 · DOI: 10.1111/tpj.12207

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014705 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006404 RNA import into nucleus Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0006610 ribosomal protein import into nucleus Biological Process

GO:0007079 mitotic chromosome movement towards spindle pole Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0030953 astral microtubule organization Biological Process

GO:0035332 positive regulation of hippo signaling Biological Process

GO:0040001 establishment of mitotic spindle localization Biological Process

GO:0045540 regulation of cholesterol biosynthetic process Biological Process

GO:0045542 positive regulation of cholesterol biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT5G53480

dme:Dmel_CG2637

hsa:3837

mmu:16211

xla:100137718

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.533

Rank 1 · LXL04_014705 · OH-1004

Nucleus0.503

Rank 2 · LXL04_014705 · OH-1004

Cell membrane0.054

Rank 3 · LXL04_014705 · OH-1004

Mitochondrion0.050

Rank 4 · LXL04_014705 · OH-1004

Endoplasmic reticulum0.047

Rank 5 · LXL04_014705 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25574.2TPR_IMB131-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014705	`PF25574.2`	TPR_IMB1	31	308	1.1e-49	169.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJD4`	Arabidopsis thaliana	Importin subunit beta-1	44.272%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card