TkA02G404200 | RubberDandelionOmics

Gene overview

TkA02G404200

Reference: TK1151 Chr: Chr02 Coordinates: 102677438-102678028 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkA02G404200|TK1151|cDNA

ATGTTCAAACTTGAAGAGACATTTAAGCCACCATATAATAATAGAGGAAGCCAAGATCTGCAAGATTTACTGTGTGGTGTTTTGTATGTGATCATTAAAAAACTCGGCAACAAGGAGGAAACAAAACCGTCAATCTTCCAAGCTGCTGACACGTTGATGGTCTTGTTTCTTCAAGTCTTTGCTTCTAGAAGCTCTAGAGTACAAAAAGAAGCCATGCTGGCGATTGGTGCCCTGGTGTACACCATAGGGCCGAAATTCGA...

CDS

Download CDS FASTA

591 bp · TkA02G404200|TK1151|CDS

ATGTTCAAACTTGAAGAGACATTTAAGCCACCATATAATAATAGAGGAAGCCAAGATCTGCAAGATTTACTGTGTGGTGTTTTGTATGTGATCATTAAAAAACTCGGCAACAAGGAGGAAACAAAACCGTCAATCTTCCAAGCTGCTGACACGTTGATGGTCTTGTTTCTTCAAGTCTTTGCTTCTAGAAGCTCTAGAGTACAAAAAGAAGCCATGCTGGCGATTGGTGCCCTGGTGTACACCATAGGGCCGAAATTCGA...

Protein

Download Protein FASTA

196 aa · TkA02G404200|TK1151|PROTEIN

MFKLEETFKPPYNNRGSQDLQDLLCGVLYVIIKKLGNKEETKPSIFQAADTLMVLFLQVFASRSSRVQKEAMLAIGALVYTIGPKFEKHMSNIWKYLELGLQNFKDYEVCNTPIGVVRDICRSSDGKMILPYYDNIMKMIPIHLSDDGLNKSVKYAFFSCFGDMPFVIGEKFGKYVYHAMDAMEKTAGNCEIKEEM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G404200`
TK1151 ID	TkA02G404200
OH-1004 ID	LXL04_014705
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 62.025 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G404200

Location Chr02:102677438-102678028 (+)

Description Similar to KPNB1: Importin subunit beta-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53480`	Acts as a negative effector of drought tolerance.	An Arabidopsis homolog of importin β1 is required for ABA response and drought tolerance.2013 · DOI: 10.1111/tpj.12207

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014705 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006404 RNA import into nucleus Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0006610 ribosomal protein import into nucleus Biological Process

GO:0007079 mitotic chromosome movement towards spindle pole Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0030953 astral microtubule organization Biological Process

GO:0035332 positive regulation of hippo signaling Biological Process

GO:0040001 establishment of mitotic spindle localization Biological Process

GO:0045540 regulation of cholesterol biosynthetic process Biological Process

GO:0045542 positive regulation of cholesterol biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT5G53480

dme:Dmel_CG2637

hsa:3837

mmu:16211

xla:100137718

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.611

Rank 1 · TkA02G404200 · TK1151

Nucleus0.384

Rank 2 · TkA02G404200 · TK1151

Endoplasmic reticulum0.062

Rank 3 · TkA02G404200 · TK1151

Cell membrane0.059

Rank 4 · TkA02G404200 · TK1151

Mitochondrion0.057

Rank 5 · TkA02G404200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25574TPR_IMB117-192 aa

PF23227HEAT_MROH2B_C57-169 aa

PF28359CandA_N62-98 aa

PF28359CandA_N136-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G404200	`PF25574`	TPR_IMB1	17	192	3.8e-36	125.3
TkA02G404200	`PF23227`	HEAT_MROH2B_C	57	169	0.16	12.0
TkA02G404200	`PF28359`	CandA_N	62	98	0.21	11.8
TkA02G404200	`PF28359`	CandA_N	136	184	0.21	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJD4`	Arabidopsis thaliana	sp\|Q9FJD4\|IMB1_ARATH Importin subunit beta-1	51.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card