LXL04_010683 | RubberDandelionOmics

Gene overview

LXL04_010683

Reference: OH-1004 Chr: Chr02 Coordinates: 151510509-151513163 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1896 bp · LXL04_010683|LXL04_010683|OH1004|cDNA

ATGGGGCATATCAATCTCACTTCACCCAAGCAACGCAACAATCCCACCCGAAAATGGCAACTTCTCGACTTCGTATCCATGGTATTCTTCGCCATCGTTGTCCTGTTCTTTCTCCTCATATTCACTCCTCTTGGCGACTCTCTTGCGGCTTCTGGGAGCCAAGCTTTGATCCGGTCCAGTACCGCCGATCCGAAGCAACGCCACCGACTCATTGCTCTGGTTGAAGCCGGCAAACATCCGGAGATTGAATCATGCCCTGC...

CDS

Download CDS FASTA

1896 bp · LXL04_010683|LXL04_010683|OH1004|CDS

ATGGGGCATATCAATCTCACTTCACCCAAGCAACGCAACAATCCCACCCGAAAATGGCAACTTCTCGACTTCGTATCCATGGTATTCTTCGCCATCGTTGTCCTGTTCTTTCTCCTCATATTCACTCCTCTTGGCGACTCTCTTGCGGCTTCTGGGAGCCAAGCTTTGATCCGGTCCAGTACCGCCGATCCGAAGCAACGCCACCGACTCATTGCTCTGGTTGAAGCCGGCAAACATCCGGAGATTGAATCATGCCCTGC...

Protein

Download Protein FASTA

631 aa · LXL04_010683|LXL04_010683|OH1004|PROTEIN

MGHINLTSPKQRNNPTRKWQLLDFVSMVFFAIVVLFFLLIFTPLGDSLAASGSQALIRSSTADPKQRHRLIALVEAGKHPEIESCPADTVDYMPCEDPTRNSQLSREMNFYRERHCPSPDETPLCLIPAPQGYHVPIQWPESLHKIWHENMPYNKIADRKGHQGWMKKDGPYFIFPGGGTMFPDGATQYIAKLKQYIPISGGTLRTALDMGCGVRTNNQESLHHLNPFITYHKNTHHLTSYQVASFGGHLLEEGILTLSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010683`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010683

Location Chr02:151510509-151513163 (+)

Description Similar to At4g00740: Probable methyltransferase PMT13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00740`	S-adenosyl-L-methionine (SAM)-dependent methyltransferase (MTase) which mediates the methylesterification of the pectin homogalacturonan (HG) and thus regulates cell wall biosynthesis, at least in suspension-cultured cells.	QUASIMODO 3 (QUA3) is a putative homogalacturonan methyltransferase regulating cell wall biosynthesis in Arabidopsis suspension-cultured cells.2011 · DOI: 10.1093/jxb/err211
`At1g33170`	Probable methyltransferase PMT18.	No verified direct reference in this release
`At4g00750`	Probable methyltransferase PMT15.	No verified direct reference in this release
`At1g26850`	Probable methyltransferase PMT2.	No verified direct reference in this release
`At4g10440`	Probable methyltransferase PMT17.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010683 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0052546 cell wall pectin metabolic process Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G26850

ath:AT1G33170

ath:AT4G00740

ath:AT4G00750

ath:AT4G10440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.771

Rank 1 · LXL04_010683 · OH-1004

Endoplasmic reticulum0.084

Rank 2 · LXL04_010683 · OH-1004

Extracellular0.068

Rank 3 · LXL04_010683 · OH-1004

Cell membrane0.065

Rank 4 · LXL04_010683 · OH-1004

Cytoplasm0.043

Rank 5 · LXL04_010683 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141.23Methyltransf_2991-215 aa

PF03141.23Methyltransf_29242-620 aa

PF08241.19Methyltransf_11282-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010683	`PF03141.23`	Methyltransf_29	91	215	5.9e-200	665.9
LXL04_010683	`PF03141.23`	Methyltransf_29	242	620	5.9e-200	665.9
LXL04_010683	`PF08241.19`	Methyltransf_11	282	332	6.1e-08	33.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93W95`	Arabidopsis thaliana	Probable pectin methyltransferase QUA3	70.159%	Swiss-Prot	strong database homology
`Q9C884`	Arabidopsis thaliana	Probable methyltransferase PMT18	41.709%	Swiss-Prot	moderate database homology
`Q9ZPH9`	Arabidopsis thaliana	Probable methyltransferase PMT15	42.376%	Swiss-Prot	moderate database homology
`B9DFI7`	Arabidopsis thaliana	Probable methyltransferase PMT2	41.207%	Swiss-Prot	moderate database homology
`Q9SZX8`	Arabidopsis thaliana	Probable methyltransferase PMT17	41.349%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card