LXL04_009609 | RubberDandelionOmics

Gene overview

LXL04_009609

Reference: OH-1004 Chr: Chr02 Coordinates: 129645266-129646472 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

824 bp · LXL04_009609|LXL04_009609|OH1004|cDNA

ATGATGTCGGAATCACAGTCAGGATGCGGGATGAACGGTGGCGATGATGGCTCCGGTGAGATCATGTTGTTCGGAGTCAGAGTGAAGGTTGATCCGATGAGGAAGAGTGTGAGTATGAACGATCTGTCACAGTATGTACAGGTACAACCTGCTACTCATGATTCGTCTAACAATAGTGCTAACCTTGATGGCTCCACCGCGATTGCTGCCGATAACGGTTACGCCTCCGCTGATGATGCTGTCCGCAACCAATCCAATGG...

CDS

Download CDS FASTA

816 bp · LXL04_009609|LXL04_009609|OH1004|CDS

ATGATGTCGGAATCACAGTCAGGATGCGGGATGAACGGTGGCGATGATGGCTCCGGTGAGATCATGTTGTTCGGAGTCAGAGTGAAGGTTGATCCGATGAGGAAGAGTGTGAGTATGAACGATCTGTCACAGTATGTACAGGTACAACCTGCTACTCATGATTCGTCTAACAATAGTGCTAACCTTGATGGCTCCACCGCGATTGCTGCCGATAACGGTTACGCCTCCGCTGATGATGCTGTCCGCAACCAATCCAATGG...

Protein

Download Protein FASTA

271 aa · LXL04_009609|LXL04_009609|OH1004|PROTEIN

MMSESQSGCGMNGGDDGSGEIMLFGVRVKVDPMRKSVSMNDLSQYVQVQPATHDSSNNSANLDGSTAIAADNGYASADDAVRNQSNGGRERKRGIPWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKYFLRRSNLNRRRRRSSLFDITTESVAAIPVEEQKNHENNNIQPAQEISPLSGFPLMAAFPTTVGPHPSPLPIEDQMEIKSTMTNVNFNQKDENNSLSLSLNLSLSYDNNRMDTSAFQFISP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009609`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009609

Location Chr02:129645266-129646472 (+)

Description Similar to Transcription factor MYB1R1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47390`	Transcriptional repressor.	A novel Arabidopsis MYB-like transcription factor, MYBH, regulates hypocotyl elongation by enhancing auxin accumulation.2013 · DOI: 10.1093/jxb/ert223 Transcriptional control of ROS homeostasis by KUODA1 regulates cell expansion during leaf development.2014 · DOI: 10.1038/ncomms4767 A single-repeat MYB transcription repressor, MYBH, participates in regulation of leaf senescence in Arabidopsis.2015 · DOI: 10.1007/s11103-015-0321-2
`At5g61620`	Probable transcription factor involved in somatic embryogenesis.	Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.2016 · DOI: 10.1016/j.jplph.2016.02.012
`At5g08520`	Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'.	Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.2015 · DOI: 10.1104/pp.15.00962

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0561400`	Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters.	Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of alpha-amylase gene expression.2002 · DOI: 10.1105/tpc.001735 A novel MYBS3-dependent pathway confers cold tolerance in rice.2010 · DOI: 10.1104/pp.110.153015

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009609 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009751 response to salicylic acid Biological Process

KEGG gene cross-reference

ath:AT5G08520

ath:AT5G47390

ath:AT5G61620

sot:102577613

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.975

Rank 1 · LXL04_009609 · OH-1004

Cytoplasm0.088

Rank 2 · LXL04_009609 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_009609 · OH-1004

Endoplasmic reticulum0.016

Rank 4 · LXL04_009609 · OH-1004

Plastid0.012

Rank 5 · LXL04_009609 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding96-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009609	`PF00249.38`	Myb_DNA-binding	96	141	2.3e-11	44.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVS0`	Arabidopsis thaliana	Transcription factor KUA1	50.829%	Swiss-Prot	moderate database homology
`Q9FKF9`	Arabidopsis thaliana	Probable transcription factor At5g61620	40.933%	Swiss-Prot	moderate database homology
`Q9FNN6`	Arabidopsis thaliana	Transcription factor SRM1	55.556%	Swiss-Prot	weak database homology
`Q7XC57`	Oryza sativa subsp. japonica	Transcription factor MYBS3	51.462%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card