LXL04_006672 | RubberDandelionOmics

Gene overview

LXL04_006672

Reference: OH-1004 Chr: Chr02 Coordinates: 22112385-22113716 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1332 bp · LXL04_006672|LXL04_006672|OH1004|cDNA

ATGCATAATCGGAGAGGGTCATCGTCGTCTTTGTCCAACGGGATTCCGATGGTCGCCGGAACTACAGTAGCTCTGCTACTACTGTGGGCGTTCTGGCCGATAATCAGCTTCACTTTTCCTTCTCCCGGCCGCCAAACCATTAATTTCAGAACCAGAGGTCATTCGTACAGAATATTTGCCGACGTAAACCACACGGTTGTCAAGGACGGACTTCGGTTTAATCTGACGCACGACCCGCCGCAACCCACATTCTACGACGA...

CDS

Download CDS FASTA

1332 bp · LXL04_006672|LXL04_006672|OH1004|CDS

ATGCATAATCGGAGAGGGTCATCGTCGTCTTTGTCCAACGGGATTCCGATGGTCGCCGGAACTACAGTAGCTCTGCTACTACTGTGGGCGTTCTGGCCGATAATCAGCTTCACTTTTCCTTCTCCCGGCCGCCAAACCATTAATTTCAGAACCAGAGGTCATTCGTACAGAATATTTGCCGACGTAAACCACACGGTTGTCAAGGACGGACTTCGGTTTAATCTGACGCACGACCCGCCGCAACCCACATTCTACGACGA...

Protein

Download Protein FASTA

443 aa · LXL04_006672|LXL04_006672|OH1004|PROTEIN

MHNRRGSSSSLSNGIPMVAGTTVALLLLWAFWPIISFTFPSPGRQTINFRTRGHSYRIFADVNHTVVKDGLRFNLTHDPPQPTFYDDPELTYTIDKPIKNWDEKRREWLSLHPTFIPGVEERVILVTGSQSKACQNPIGDHLLLRFFKNKVDYCRIHGHDIFYNNVLFHPDMFTYWAKIPSVRAVMLAHPEAEWIWWVDSDAVFTDMDFKLPLERYKNHNFVVHGWPEMIYKKKSWTGLNAGVFLIRNNQWALDFMEVWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006672`
TK1151 ID	TkA03G057410
OH-1004 ID	LXL04_006672
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.400
Protein coverage (%)	TK1151 100.000 / OH-1004 96.388 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006672

Location Chr02:22112385-22113716 (-)

Description Similar to GMGT1: Galactomannan galactosyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22900`	Probable glycosyltransferase that may be involved in the biosynthesis of xyloglucan.	No verified direct reference in this release
`At4g37690`	Probable glycosyltransferase that may be involved in the biosynthesis of xyloglucan.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0723200`	Probable glycosyltransferase that may be involved in the biosynthesis of xyloglucan.	No verified direct reference in this release
`UniProt: A2X933`	Probable glycosyltransferase that may be involved in the biosynthesis of xyloglucan.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006672 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010192 mucilage biosynthetic process Biological Process

GO:0010214 seed coat development Biological Process

GO:0010392 galactoglucomannan metabolic process Biological Process

GO:0051070 galactomannan biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0008378 galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G22900

ath:AT4G37690

dosa:Os02g0723200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.802

Rank 1 · LXL04_006672 · OH-1004

Endoplasmic reticulum0.117

Rank 2 · LXL04_006672 · OH-1004

Cytoplasm0.087

Rank 3 · LXL04_006672 · OH-1004

Cell membrane0.053

Rank 4 · LXL04_006672 · OH-1004

Extracellular0.049

Rank 5 · LXL04_006672 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05637.19Glyco_transf_34120-391 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006672	`PF05637.19`	Glyco_transf_34	120	391	9.8e-59	199.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81007`	Arabidopsis thaliana	Putative glycosyltransferase 7	63.073%	Swiss-Prot	strong database homology
`Q9SZG1`	Arabidopsis thaliana	Glycosyltransferase 6	54.920%	Swiss-Prot	strong database homology
`Q6Z5M3`	Oryza sativa subsp. japonica	Probable glycosyltransferase 7	57.025%	Swiss-Prot	strong database homology
`A2X933`	Oryza sativa subsp. indica	Probable glycosyltransferase 7	57.025%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card