RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_005323
Reference: OH-1004 Chr: Chr01 Coordinates: 160381087-160381476 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

390 bp · LXL04_005323|LXL04_005323|OH1004|cDNA

ATGGCAAGCACCTCACTTGCATGCAgtatcttcatcttcttcctcaTCATTTGCAACGTCTCATTTTCCGATGCTTGCGGTACATGCACACCAACGAAACCAATGCCACCACCCAAGGCTCCCCCTGCAAACCCCTCTTGCCCTAGAGACACCTTGAAGCTTGGAGTGTGTGCCGACGTTTTAGGGTTGGTGAATGTTGTTATTGGGTCCCAGGAATCTAGCAAATGTTGTGCGTTGCTTGAGGGTTTGGTTGATTTGGA...

CDS

Download CDS FASTA

390 bp · LXL04_005323|LXL04_005323|OH1004|CDS

ATGGCAAGCACCTCACTTGCATGCAGTATCTTCATCTTCTTCCTCATCATTTGCAACGTCTCATTTTCCGATGCTTGCGGTACATGCACACCAACGAAACCAATGCCACCACCCAAGGCTCCCCCTGCAAACCCCTCTTGCCCTAGAGACACCTTGAAGCTTGGAGTGTGTGCCGACGTTTTAGGGTTGGTGAATGTTGTTATTGGGTCCCAGGAATCTAGCAAATGTTGTGCGTTGCTTGAGGGTTTGGTTGATTTGGA...

Protein

Download Protein FASTA

129 aa · LXL04_005323|LXL04_005323|OH1004|PROTEIN

MASTSLACSIFIFFLIICNVSFSDACGTCTPTKPMPPPKAPPANPSCPRDTLKLGVCADVLGLVNVVIGSQESSKCCALLEGLVDLEVAACLCTAIKANVLGINLNVPISLSVLVSACGKTVPPGFKCE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_005323
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_005323
LocationChr01:160381087-160381476 (-)
DescriptionSimilar to 14 kDa proline-rich protein DC2.15
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g12490 Probable lipid transfer protein (LTP).
Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x
At4g00165 Putative lipid-binding protein At4g00165. No verified direct reference in this release
At4g12470 Probable lipid transfer protein (LTP).
Priming in systemic plant immunity.2009 · DOI: 10.1126/science.1170025
Cold-inducible expression of AZI1 and its function in improvement of freezing tolerance of Arabidopsis thaliana and Saccharomyces cerevisiae.2011 · DOI: 10.1016/j.jplph.2011.01.023
Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x
Metabolomic analysis reveals the relationship between AZI1 and sugar signaling in systemic acquired resistance of Arabidopsis.2016 · DOI: 10.1016/j.plaphy.2016.06.016
At4g12480 Probable lipid transfer protein (LTP).
Cold responsive EARLI1 type HyPRPs improve freezing survival of yeast cells and form higher order complexes in plants.2007 · DOI: 10.1007/s00425-007-0611-2
The HyPRP gene EARLI1 has an auxiliary role for germinability and early seedling development under low temperature and salt stress conditions in Arabidopsis thaliana.2011 · DOI: 10.1007/s00425-011-1425-9
Influence of EARLI1-like genes on flowering time and lignin synthesis of Arabidopsis thaliana.2011 · DOI: 10.1111/j.1438-8677.2010.00428.x
Expression of recombinant EARLI1, a hybrid proline-rich protein of Arabidopsis, in Escherichia coli and its inhibition effect to the growth of fungal pathogens and Saccharomyces cerevisiae.2012 · DOI: 10.1016/j.gene.2012.06.070

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005323 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0009409 response to cold Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009627 systemic acquired resistance Biological Process
GO:0009631 cold acclimation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009682 induced systemic resistance Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0070417 cellular response to cold Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
KEGG gene cross-reference
ath:AT4G00165
ath:AT4G12470
ath:AT4G12480
ath:AT4G12490
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.457
Rank 1 · LXL04_005323 · OH-1004
Endoplasmic reticulum0.186
Rank 2 · LXL04_005323 · OH-1004
Lysosome / Vacuole0.175
Rank 3 · LXL04_005323 · OH-1004
Cytoplasm0.153
Rank 4 · LXL04_005323 · OH-1004
Cell membrane0.090
Rank 5 · LXL04_005323 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368.12LTP_235-128 aa
PF14547.12Hydrophob_seed47-128 aa
PF00234.28Tryp_alpha_amyl47-128 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_005323PF14368.12LTP_2351285.4e-0833.6
LXL04_005323PF14547.12Hydrophob_seed471289.2e-29100.3
LXL04_005323PF00234.28Tryp_alpha_amyl471281.1e-1558.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SU34Arabidopsis thalianapEARLI1-like lipid transfer protein 258.065%Swiss-Protstrong database homology
Q8RW93Arabidopsis thalianaPutative lipid-binding protein At4g0016553.608%Swiss-Protstrong database homology
Q9SU35Arabidopsis thalianapEARLI1-like lipid transfer protein 161.905%Swiss-Protmoderate database homology
Q39176Arabidopsis thalianaLipid transfer protein EARLI 160.714%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser