LXL04_001283 | RubberDandelionOmics

Gene overview

LXL04_001283

Reference: OH-1004 Chr: Chr01 Coordinates: 23421532-23422874 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · LXL04_001283|LXL04_001283|OH1004|cDNA

ATGTCACCGATGTCGATGGTGGAATTAGATTTGACTGTACATCAGCACCTACATATTGTTGAAGCTATTTTTTTGGGTTTTACAGGAGGTGATGGTATAGAAATAGAGGAAATCCCTTATAACACTTGGAAGGGAAAACAAAGTATATCTTTGGAACCTGGAGGGCAGTTTGAGCTTAGTGGTGCTCCTCTTGAAACTCTCCATCAAACATGTGCAGAAGTTAATTCACATCTTTACCATGTTAAAGTTGTTGCTGAAGA...

CDS

Download CDS FASTA

432 bp · LXL04_001283|LXL04_001283|OH1004|CDS

ATGTCACCGATGTCGATGGTGGAATTAGATTTGACTGTACATCAGCACCTACATATTGTTGAAGCTATTTTTTTGGGTTTTACAGGAGGTGATGGTATAGAAATAGAGGAAATCCCTTATAACACTTGGAAGGGAAAACAAAGTATATCTTTGGAACCTGGAGGGCAGTTTGAGCTTAGTGGTGCTCCTCTTGAAACTCTCCATCAAACATGTGCAGAAGTTAATTCACATCTTTACCATGTTAAAGTTGTTGCTGAAGA...

Protein

Download Protein FASTA

143 aa · LXL04_001283|LXL04_001283|OH1004|PROTEIN

MSPMSMVELDLTVHQHLHIVEAIFLGFTGGDGIEIEEIPYNTWKGKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYHVKVVAEEMIGFIGIGFQPKLKCKDIPIRRKGRYEIMRNYMPKVGSLGLDMMFRLIWTSHLKRT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001283`
TK1151 ID	TkAUNG044810
OH-1004 ID	LXL04_001283
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 80.420 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001283

Location Chr01:23421532-23422874 (-)

Description Similar to GSH1-2: Glutamate--cysteine ligase B, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YL07`	Glutamate--cysteine ligase B, chloroplastic.	No verified direct reference in this release
`Os07g0462000`	Glutamate--cysteine ligase B, chloroplastic.	No verified direct reference in this release
`Os05g0129000`	Glutamate--cysteine ligase A, chloroplastic.	No verified direct reference in this release
`UniProt: Q8GU95`	Glutamate--cysteine ligase A, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001283 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006750 glutathione biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0004357 glutamate-cysteine ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

dosa:Os05g0129000

dosa:Os07g0462000

nta:107799938

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.300

Rank 1 · LXL04_001283 · OH-1004

Mitochondrion0.176

Rank 2 · LXL04_001283 · OH-1004

Nucleus0.158

Rank 3 · LXL04_001283 · OH-1004

Peroxisome0.150

Rank 4 · LXL04_001283 · OH-1004

Extracellular0.098

Rank 5 · LXL04_001283 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04107.19GCS246-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001283	`PF04107.19`	GCS2	46	133	2.5e-19	70.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2YL07`	Oryza sativa subsp. indica	Glutamate--cysteine ligase B, chloroplastic	86.813%	Swiss-Prot	moderate database homology
`Q6Z3A3`	Oryza sativa subsp. japonica	Glutamate--cysteine ligase B, chloroplastic	86.813%	Swiss-Prot	moderate database homology
`Q688Q9`	Oryza sativa subsp. japonica	Glutamate--cysteine ligase A, chloroplastic	86.813%	Swiss-Prot	moderate database homology
`Q8GU95`	Oryza sativa subsp. indica	Glutamate--cysteine ligase A, chloroplastic	86.813%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card