TkAUNG044810 | RubberDandelionOmics

Gene overview

TkAUNG044810

Reference: TK1151 Chr: ChrUn Coordinates: 12457240-12459945 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · TkAUNG044810|TK1151|cDNA

GGAGGTGATGGTATAGAAATAGAGGAAATCCCTTATAACACTTGGAAGGGAAAACAAAGTATATCTTTGGAACCTGGAGGGCAGTTTGAGCTTAGTGGTGCTCCTCTTGAAACTCTCCATCAAACATGTGCAGAAGTTAATTCACATCTTTACCATGTTAAAGTTGTTGCTGAAGAGATGATTGGATTTATAGGAATTGGTTTTCAACCAAAATTGAAATGTAAAGATATACCTATTAGGCGCAAGGGAAGATATGAGAT...

CDS

Download CDS FASTA

348 bp · TkAUNG044810|TK1151|CDS

GGAGGTGATGGTATAGAAATAGAGGAAATCCCTTATAACACTTGGAAGGGAAAACAAAGTATATCTTTGGAACCTGGAGGGCAGTTTGAGCTTAGTGGTGCTCCTCTTGAAACTCTCCATCAAACATGTGCAGAAGTTAATTCACATCTTTACCATGTTAAAGTTGTTGCTGAAGAGATGATTGGATTTATAGGAATTGGTTTTCAACCAAAATTGAAATGTAAAGATATACCTATTAGGCGCAAGGGAAGATATGAGAT...

Protein

Download Protein FASTA

115 aa · TkAUNG044810|TK1151|PROTEIN

GGDGIEIEEIPYNTWKGKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYHVKVVAEEMIGFIGIGFQPKLKCKDIPIRRKGRYEIMRNYMPKVGSLGLDMMFRLIWTSHLKRT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG044810`
TK1151 ID	TkAUNG044810
OH-1004 ID	LXL04_001283
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 80.420 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG044810

Location ChrUn:12457240-12459945 (-)

Description Similar to GSH1-2: Glutamate--cysteine ligase B, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q8GU95`	Glutamate--cysteine ligase A, chloroplastic.	No verified direct reference in this release
`Os05g0129000`	Glutamate--cysteine ligase A, chloroplastic.	No verified direct reference in this release
`UniProt: A2YL07`	Glutamate--cysteine ligase B, chloroplastic.	No verified direct reference in this release
`Os07g0462000`	Glutamate--cysteine ligase B, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001283 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006750 glutathione biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0004357 glutamate-cysteine ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

dosa:Os05g0129000

dosa:Os07g0462000

nta:107799938

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.270

Rank 1 · TkAUNG044810 · TK1151

Extracellular0.221

Rank 2 · TkAUNG044810 · TK1151

Peroxisome0.149

Rank 3 · TkAUNG044810 · TK1151

Nucleus0.124

Rank 4 · TkAUNG044810 · TK1151

Mitochondrion0.117

Rank 5 · TkAUNG044810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04107GCS219-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG044810	`PF04107`	GCS2	19	105	1.5e-19	71.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GU95`	Oryza sativa subsp. indica	sp\|Q8GU95\|GSH1A_ORYSI Glutamate--cysteine ligase A, chloroplastic	78.800%	Swiss-Prot	High
`Q688Q9`	Oryza sativa subsp. japonica	sp\|Q688Q9\|GSH1A_ORYSJ Glutamate--cysteine ligase A, chloroplastic	78.800%	Swiss-Prot	High
`A2YL07`	Oryza sativa subsp. indica	sp\|A2YL07\|GSH1B_ORYSI Glutamate--cysteine ligase B, chloroplastic	78.800%	Swiss-Prot	High
`Q6Z3A3`	Oryza sativa subsp. japonica	sp\|Q6Z3A3\|GSH1B_ORYSJ Glutamate--cysteine ligase B, chloroplastic	78.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card