LXL04_000920 | RubberDandelionOmics

Gene overview

LXL04_000920

Reference: OH-1004 Chr: Chr01 Coordinates: 16654087-16656503 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1335 bp · LXL04_000920|LXL04_000920|OH1004|cDNA

ATGGATCATATTGTTGGTGGAAAGTTTAAGCTTGGAAGGAAAATTGGCAGCGGATCATTTGGGGAACTTTTTTTAGGTGTTAATATTCAAACCGGAGAAGAAGTAGCTGTTAAACTGGAAGGCGTCAAGACAAGGCATCCTCAACTTCATTATGAGTCAAAAATTTATAGGCTTCTCCAAGGAGGAACGGGAGTACCAAACCTTAAATGGTTTGGTGTTGAGGGCGAGTACAATATCATGGTCATTGACCTTCTTGGACC...

CDS

Download CDS FASTA

1335 bp · LXL04_000920|LXL04_000920|OH1004|CDS

ATGGATCATATTGTTGGTGGAAAGTTTAAGCTTGGAAGGAAAATTGGCAGCGGATCATTTGGGGAACTTTTTTTAGGTGTTAATATTCAAACCGGAGAAGAAGTAGCTGTTAAACTGGAAGGCGTCAAGACAAGGCATCCTCAACTTCATTATGAGTCAAAAATTTATAGGCTTCTCCAAGGAGGAACGGGAGTACCAAACCTTAAATGGTTTGGTGTTGAGGGCGAGTACAATATCATGGTCATTGACCTTCTTGGACC...

Protein

Download Protein FASTA

444 aa · LXL04_000920|LXL04_000920|OH1004|PROTEIN

MDHIVGGKFKLGRKIGSGSFGELFLGVNIQTGEEVAVKLEGVKTRHPQLHYESKIYRLLQGGTGVPNLKWFGVEGEYNIMVIDLLGPSLEDLFNYCNRKFSLKTVLMLADQLLNRVEYMHARGFLHRDLKPDNFLMGLGRKANQVYAIDFGLAKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLESLGYVLMYFIRGSLPWQGLKAGNKKQKYDKISEKKMLTPIEVLCKSYPSEFISYFHYCRSLRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000920`
TK1151 ID	TkA01G576320
OH-1004 ID	LXL04_000920
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.800
Protein coverage (%)	TK1151 98.925 / OH-1004 62.162 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000920

Location Chr01:16654087-16656503 (-)

Description Similar to CKL9: Casein kinase 1-like protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03930`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At4g14340`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At4g28540`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Arabidopsis casein kinase 1-like 6 contains a microtubule-binding domain and affects the organization of cortical microtubules,2008 · DOI: 10.1104/pp.108.129346 Versatile casein kinase 1: multiple locations and functions.2009 · DOI: 10.1104/pp.108.129346
`At3g23340`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0622100`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Roles of OsCKI1, a rice casein kinase I, in root development and plant hormone sensitivity.2003 · DOI: 10.1046/j.1365-313x.2003.01866.x Rice LTG1 is involved in adaptive growth and fitness under low ambient temperature.2014 · DOI: 10.1111/tpj.12487

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000920 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0006897 endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009850 auxin metabolic process Biological Process

GO:0016310 phosphorylation Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:0051510 regulation of unidimensional cell growth Biological Process

KEGG gene cross-reference

ath:AT1G03930

ath:AT3G23340

ath:AT4G14340

ath:AT4G28540

dosa:Os02g0622100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.620

Rank 1 · LXL04_000920 · OH-1004

Nucleus0.386

Rank 2 · LXL04_000920 · OH-1004

Cell membrane0.090

Rank 3 · LXL04_000920 · OH-1004

Mitochondrion0.074

Rank 4 · LXL04_000920 · OH-1004

Endoplasmic reticulum0.046

Rank 5 · LXL04_000920 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase10-227 aa

PF07714.24PK_Tyr_Ser-Thr10-269 aa

PF17667.8Pkinase_fungal120-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000920	`PF00069.32`	Pkinase	10	227	1.8e-25	90.6
LXL04_000920	`PF07714.24`	PK_Tyr_Ser-Thr	10	269	5.6e-14	52.8
LXL04_000920	`PF17667.8`	Pkinase_fungal	120	206	4.3e-07	29.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZWB3`	Arabidopsis thaliana	Casein kinase 1-like protein 9	68.288%	Swiss-Prot	strong database homology
`Q39050`	Arabidopsis thaliana	Casein kinase 1-like protein 11	69.481%	Swiss-Prot	strong database homology
`Q8LPJ1`	Arabidopsis thaliana	Casein kinase 1-like protein 6	67.917%	Swiss-Prot	strong database homology
`Q9LW62`	Arabidopsis thaliana	Casein kinase 1-like protein 10	70.087%	Swiss-Prot	strong database homology
`Q6K9N1`	Oryza sativa subsp. japonica	Casein kinase 1	67.742%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card