LXL04_000196 | RubberDandelionOmics

Gene overview

LXL04_000196

Reference: OH-1004 Chr: Chr01 Coordinates: 3890669-3891595 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

927 bp · LXL04_000196|LXL04_000196|OH1004|cDNA

ATGGGCGACGAGTTAGCTTTGATCAATTCTCCGTCTCCGGTGGCCGTTGCCGGAGGCAACCATCCTCATTCATCTCGTCCGCTCCCTTTCCGTGAGGATTGTTGGAGCGAGGATGCGACGTCCACGCTCGTCGACGCTTGGGGGCGCCGTTACCTTGAGCTCAACCGTGGGAACCTCCGTCAAAAGGATTGGCAGGAGGTCGCCGATGCCGTCAACGCCCGTCACGGCCACACCAAAAAAACCAGGCGTACCGATGTTCA...

CDS

Download CDS FASTA

927 bp · LXL04_000196|LXL04_000196|OH1004|CDS

ATGGGCGACGAGTTAGCTTTGATCAATTCTCCGTCTCCGGTGGCCGTTGCCGGAGGCAACCATCCTCATTCATCTCGTCCGCTCCCTTTCCGTGAGGATTGTTGGAGCGAGGATGCGACGTCCACGCTCGTCGACGCTTGGGGGCGCCGTTACCTTGAGCTCAACCGTGGGAACCTCCGTCAAAAGGATTGGCAGGAGGTCGCCGATGCCGTCAACGCCCGTCACGGCCACACCAAAAAAACCAGGCGTACCGATGTTCA...

Protein

Download Protein FASTA

308 aa · LXL04_000196|LXL04_000196|OH1004|PROTEIN

MGDELALINSPSPVAVAGGNHPHSSRPLPFREDCWSEDATSTLVDAWGRRYLELNRGNLRQKDWQEVADAVNARHGHTKKTRRTDVQCKNRIDTLKKKYKVEKARVSESNGQISSNWPFYSRLDSLIGSAATAKKSSSSSPPTAVPLPYRKPPSTVLSSQFPQPLAVLPQKRPLPVAAAVDESYFRRNYSAVAAAAAAAEEDGSEDDESLGTSDDEGGAGGEGVRKEGGAVGDSDCMKRLARAIERFGEIYERVEGEKQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000196`
TK1151 ID	TkA01G627850
OH-1004 ID	LXL04_000196
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.600
Protein coverage (%)	TK1151 90.400 / OH-1004 36.688 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000196

Location Chr01:3890669-3891595 (-)

Description Similar to ASIL2: Trihelix transcription factor ASIL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14180`	Transcription regulator that may repress the maturation program during early embryogenesis.	MicroRNAs regulate the timing of embryo maturation in Arabidopsis.2011 · DOI: 10.1104/pp.110.171355
`At3g11100`	Transcription regulator.	Interaction of Arabidopsis Trihelix-Domain Transcription Factors VFP3 and VFP5 with Agrobacterium Virulence Protein VirF.2015 · DOI: 10.1371/journal.pone.0142128
`At5g05550`	Probable transcription regulator (By similarity).	No verified direct reference in this release
`At1g54060`	Transcription repressor that binds specific DNA sequence such as the GT-box-like motif 5'-CGTGATT-3' in the AT2S3 promoter.	Repression of seed maturation genes by a trihelix transcriptional repressor in Arabidopsis seedlings.2009 · DOI: 10.1105/tpc.108.061309 MicroRNAs regulate the timing of embryo maturation in Arabidopsis.2011 · DOI: 10.1104/pp.110.171355 ASIL1 is required for proper timing of seed filling in Arabidopsis.2011 · DOI: 10.4161/psb.6.12.18709

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000196 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G54060

ath:AT3G11100

ath:AT3G14180

ath:AT5G05550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.983

Rank 1 · LXL04_000196 · OH-1004

Cytoplasm0.058

Rank 2 · LXL04_000196 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_000196 · OH-1004

Endoplasmic reticulum0.015

Rank 4 · LXL04_000196 · OH-1004

Plastid0.008

Rank 5 · LXL04_000196 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837.13Myb_DNA-bind_433-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000196	`PF13837.13`	Myb_DNA-bind_4	33	126	9.4e-20	71.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJG8`	Arabidopsis thaliana	Trihelix transcription factor ASIL2	36.119%	Swiss-Prot	moderate database homology
`Q8VZI9`	Arabidopsis thaliana	Trihelix transcription factor ENAP1	43.494%	Swiss-Prot	moderate database homology
`Q9FFG0`	Arabidopsis thaliana	Trihelix transcription factor ENAP2	42.029%	Swiss-Prot	moderate database homology
`Q9SYG2`	Arabidopsis thaliana	Trihelix transcription factor ASIL1	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card