LXL04_038735 | RubberDandelionOmics

Gene overview

LXL04_038735

Reference: OH-1004 Chr: Chr09 Coordinates: 49145731-49146756 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

930 bp · LXL04_038735|LXL04_038735|OH1004|cDNA

ATGTCATTTCTGCCTCGTCGTCGTGTCATCGTAAATGGGAACCAGCGGATGAGAACTTATCATTATTACTGGTGTAGACGTTGTCAAAGAACATTTAGAACAAACTCAAATAACTTACCTGAAACTGTATGCCCACGTTGTTTAGGTATTATTCCTGATGAACTTGATTTCCATCGGCCCAGGTTGGTATCCAACATCGCAAATATTGAACCTCATTTAGCCACACAGTTTATTGAGAATTTGGCTCTTCTATTCGACCC...

CDS

Download CDS FASTA

930 bp · LXL04_038735|LXL04_038735|OH1004|CDS

ATGTCATTTCTGCCTCGTCGTCGTGTCATCGTAAATGGGAACCAGCGGATGAGAACTTATCATTATTACTGGTGTAGACGTTGTCAAAGAACATTTAGAACAAACTCAAATAACTTACCTGAAACTGTATGCCCACGTTGTTTAGGTATTATTCCTGATGAACTTGATTTCCATCGGCCCAGGTTGGTATCCAACATCGCAAATATTGAACCTCATTTAGCCACACAGTTTATTGAGAATTTGGCTCTTCTATTCGACCC...

Protein

Download Protein FASTA

309 aa · LXL04_038735|LXL04_038735|OH1004|PROTEIN

MSFLPRRRVIVNGNQRMRTYHYYWCRRCQRTFRTNSNNLPETVCPRCLGIIPDELDFHRPRLVSNIANIEPHLATQFIENLALLFDPPQSPPQFIRQQDPDTEIEQALDSNFIFHVTGSQPNGGYLDHQNATLEEPHDVSNEEEGTRPPQTPISVIEALPLVSLTQSHLANDSHCPVCKDEFEVGGEVRELPCKHFYHHDCIIPWLSAHNTCPVCRYEIQGLSNTYGQTHYEEDGFTRQDSRNHINMNRSLEQFITLWPF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038735`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038735

Location Chr09:49145731-49146756 (+)

Description Similar to RZF1: E3 ubiquitin-protein ligase RZF1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56580`	E3 ubiquitin-protein ligase that promotes osmotic stress and abscisic acid (ABA) responses.	The atrzf1 mutation of the novel RING-type E3 ubiquitin ligase increases proline contents and enhances drought tolerance in Arabidopsis.2013 · DOI: 10.1016/j.plantsci.2012.12.007 PCA22 acts as a suppressor of atrzf1 to mediate proline accumulation in response to abiotic stress in Arabidopsis.2017 · DOI: 10.1093/jxb/erx069
`At2g40830`	Probable E3 ubiquitin-protein ligase that may possess E3 ubiquitin ligase activity in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038735 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0035519 protein K29-linked ubiquitination Biological Process

GO:0044314 protein K27-linked ubiquitination Biological Process

GO:0047484 regulation of response to osmotic stress Biological Process

GO:0090378 seed trichome elongation Biological Process

GO:1902006 negative regulation of L-proline biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT2G40830

ath:AT3G56580

xla:432033

xtr:448402

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.502

Rank 1 · LXL04_038735 · OH-1004

Nucleus0.473

Rank 2 · LXL04_038735 · OH-1004

Endoplasmic reticulum0.109

Rank 3 · LXL04_038735 · OH-1004

Mitochondrion0.062

Rank 4 · LXL04_038735 · OH-1004

Lysosome / Vacuole0.056

Rank 5 · LXL04_038735 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_2174-216 aa

PF13923.13zf-C3HC4_2175-215 aa

PF17123.12zf-RING_11175-202 aa

PF00097.32zf-C3HC4175-215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038735	`PF13639.13`	zf-RING_2	174	216	1.2e-13	51.7
LXL04_038735	`PF13923.13`	zf-C3HC4_2	175	215	4.2e-09	36.8
LXL04_038735	`PF17123.12`	zf-RING_11	175	202	1.1e-07	32.1
LXL04_038735	`PF00097.32`	zf-C3HC4	175	215	4.1e-07	30.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AK4`	Arabidopsis thaliana	E3 ubiquitin-protein ligase RZF1	34.322%	Swiss-Prot	moderate database homology
`O22197`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase RHC1A	43.802%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card