LXL04_037943 | RubberDandelionOmics

Gene overview

LXL04_037943

Reference: OH-1004 Chr: Chr09 Coordinates: 25903223-25904935 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1713 bp · LXL04_037943|LXL04_037943|OH1004|cDNA

ATGGCTCCGTACTTTTATCACTTTAGTTTGTTGCAAACCATCTTGGTTGTATACTCCTTGGTCATATTCACATGTAACGGATCATCACTAAGCCATTATGATGAATGCTTCGCCTTGTTTCAGTTTAAGAAAAGCATAATTCATCAAGATGATGTGGATTGTGCTGCTAGTTGGTTTCAAACATTCCACACTTGGAAGCCCACATCAGATTCTGTTTTTGATTGTTGTTTATGGTATGGGGTTGAGTGCAGCAATGACCA...

CDS

Download CDS FASTA

1713 bp · LXL04_037943|LXL04_037943|OH1004|CDS

ATGGCTCCGTACTTTTATCACTTTAGTTTGTTGCAAACCATCTTGGTTGTATACTCCTTGGTCATATTCACATGTAACGGATCATCACTAAGCCATTATGATGAATGCTTCGCCTTGTTTCAGTTTAAGAAAAGCATAATTCATCAAGATGATGTGGATTGTGCTGCTAGTTGGTTTCAAACATTCCACACTTGGAAGCCCACATCAGATTCTGTTTTTGATTGTTGTTTATGGTATGGGGTTGAGTGCAGCAATGACCA...

Protein

Download Protein FASTA

570 aa · LXL04_037943|LXL04_037943|OH1004|PROTEIN

MAPYFYHFSLLQTILVVYSLVIFTCNGSSLSHYDECFALFQFKKSIIHQDDVDCAASWFQTFHTWKPTSDSVFDCCLWYGVECSNDHEYDHVIGVDLSGCSLCGNINSTSTLFSLVHLQSLDLSMNYFRDSQIPSEIAHLKKLRILNLSDSGFSGHVPNEISHLMQLSSLDLSWNSLKLQSPSGLKNLLTNLTGLEELHLSGVEISYFVPHFLANFSSLRSIKLYNCSLKNEFPSAILHLPKLKILDVSSNLNLTGSLPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037943`
TK1151 ID	TkA04G359560
OH-1004 ID	LXL04_037943
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.000
Protein coverage (%)	TK1151 91.436 / OH-1004 57.895 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037943

Location Chr09:25903223-25904935 (-)

Description Similar to RLP6: Receptor-like protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g45616`	Receptor-like protein 6.	No verified direct reference in this release
`At1g47890`	Receptor-like protein 7.	No verified direct reference in this release
`At5g27060`	Receptor-like protein 53.	No verified direct reference in this release
`At2g15080`	Receptor-like protein 19.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037943 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G45616

ath:AT1G47890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.756

Rank 1 · LXL04_037943 · OH-1004

Endoplasmic reticulum0.137

Rank 2 · LXL04_037943 · OH-1004

Cytoplasm0.079

Rank 3 · LXL04_037943 · OH-1004

Nucleus0.078

Rank 4 · LXL04_037943 · OH-1004

Extracellular0.028

Rank 5 · LXL04_037943 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_1495-295 aa

PF13855.13LRR_8117-177 aa

PF25019.1LRR_R13L1-DRL21141-249 aa

PF25013.1LRR_Zer-1187-256 aa

PF23598.2LRR_14213-320 aa

PF13855.13LRR_8266-322 aa

PF23598.2LRR_14307-435 aa

PF13855.13LRR_8356-396 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037943	`PF23598.2`	LRR_14	95	295	3e-25	89.5
LXL04_037943	`PF13855.13`	LRR_8	117	177	4.3e-25	88.0
LXL04_037943	`PF25019.1`	LRR_R13L1-DRL21	141	249	2.6e-08	34.5
LXL04_037943	`PF25013.1`	LRR_Zer-1	187	256	7e-12	46.4
LXL04_037943	`PF23598.2`	LRR_14	213	320	3e-25	89.5
LXL04_037943	`PF13855.13`	LRR_8	266	322	4.3e-25	88.0
LXL04_037943	`PF23598.2`	LRR_14	307	435	3e-25	89.5
LXL04_037943	`PF13855.13`	LRR_8	356	396	4.3e-25	88.0
LXL04_037943	`PF12799.14`	LRR_4	384	421	5.8e-17	62.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C637`	Arabidopsis thaliana	Receptor-like protein 6	33.048%	Swiss-Prot	moderate database homology
`Q9C699`	Arabidopsis thaliana	Receptor-like protein 7	32.428%	Swiss-Prot	moderate database homology
`Q9S9U3`	Arabidopsis thaliana	Receptor-like protein 53	33.469%	Swiss-Prot	moderate database homology
`Q9ZUK3`	Arabidopsis thaliana	Receptor-like protein 19	30.594%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card