LXL04_037811 | RubberDandelionOmics

Gene overview

LXL04_037811

Reference: OH-1004 Chr: Chr09 Coordinates: 21835530-21838155 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · LXL04_037811|LXL04_037811|OH1004|cDNA

ATGGCGGCATCTTCTGTGACACTTGTCGTCTTTTTTTGTCTCCTCTTTCAAGTTAACTCTGAAAAAAGATCAAACCTAAACGGCTTCAATCTGCAAAAGACTTCAATCAAATCCTTGAAGCATCTTCACTCTTCTATTTGCCGTCGACCTCTTCCGGTGCTTGGTTCTTCCGTGACGCCAATAGATTTGCTTCCAATTTCTCAGATCTACTTTCAGATAAACTATTTTCCTTCTGTGGTTAATCTTGTCAATCGTGTGAA...

CDS

Download CDS FASTA

864 bp · LXL04_037811|LXL04_037811|OH1004|CDS

ATGGCGGCATCTTCTGTGACACTTGTCGTCTTTTTTTGTCTCCTCTTTCAAGTTAACTCTGAAAAAAGATCAAACCTAAACGGCTTCAATCTGCAAAAGACTTCAATCAAATCCTTGAAGCATCTTCACTCTTCTATTTGCCGTCGACCTCTTCCGGTGCTTGGTTCTTCCGTGACGCCAATAGATTTGCTTCCAATTTCTCAGATCTACTTTCAGATAAACTATTTTCCTTCTGTGGTTAATCTTGTCAATCGTGTGAA...

Protein

Download Protein FASTA

287 aa · LXL04_037811|LXL04_037811|OH1004|PROTEIN

MAASSVTLVVFFCLLFQVNSEKRSNLNGFNLQKTSIKSLKHLHSSICRRPLPVLGSSVTPIDLLPISQIYFQINYFPSVVNLVNRVKKKLGNGHKKEPFNGHLLLHAAFLGVEYPTPFHAALHGGGVPRQFPALPGASSASSTAFYARLEEGLELISGLRSLRVLNLSHNGFVGKLPESLSFLKNLNEVSLSNKLSGPVYQSFVENIPANAVVDLSFNALTGQIPQMMSLSNQKEEYFARNLDLCGKPLKKMCRIPSSHS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037811`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037811

Location Chr09:21835530-21838155 (-)

Description Similar to At4g34220: Receptor protein kinase-like protein At4g34220

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34220`	Receptor protein kinase-like protein At4g34220.	No verified direct reference in this release
`At5g40170`	Receptor-like protein 54.	No verified direct reference in this release
`At4g37250`	Probable LRR receptor-like serine/threonine-protein kinase At4g37250.	No verified direct reference in this release
`At3g05660`	Receptor-like protein 33.	No verified direct reference in this release
`At4g13900`	Receptor-like protein 49.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037811 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G05660

ath:AT4G34220

ath:AT4G37250

ath:AT5G40170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.307

Rank 1 · LXL04_037811 · OH-1004

Endoplasmic reticulum0.249

Rank 2 · LXL04_037811 · OH-1004

Nucleus0.216

Rank 3 · LXL04_037811 · OH-1004

Cytoplasm0.199

Rank 4 · LXL04_037811 · OH-1004

Extracellular0.095

Rank 5 · LXL04_037811 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94C77`	Arabidopsis thaliana	Receptor protein kinase-like protein At4g34220	48.361%	Swiss-Prot	weak database homology
`F4KHA2`	Arabidopsis thaliana	Receptor-like protein 54	35.616%	Swiss-Prot	weak database homology
`C0LGS3`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At4g37250	33.775%	Swiss-Prot	weak database homology
`F4J8G2`	Arabidopsis thaliana	Receptor-like protein 33	36.842%	Swiss-Prot	weak database homology
`Q9SVM3`	Arabidopsis thaliana	Receptor-like protein 49	44.444%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card