LXL04_037572 | RubberDandelionOmics

Gene overview

LXL04_037572

Reference: OH-1004 Chr: Chr09 Coordinates: 15002580-15006842 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1773 bp · LXL04_037572|LXL04_037572|OH1004|cDNA

ATGTTCACCAAGTTCATGCTCCGACCACCTTGCTCCGTTTCAATTCCTCTCTCTCCGTCTCTTACACCCTTCTTCTCTAACCCCTGCACCGCCATCTCTATCCGTCGTAGTGCCGTCGTCTCCGCTGCAGCTTCCCTTTCTGTGACCCTCGACGAAACTCTCCCTTACGGACCTTCTTTATCCAAAGGCTACCAACCACCCTCTATAGAAACCAAATCGCCACAGCAAGATACCGAAATCTTTTTCGATGAAACTCGGTT...

CDS

Download CDS FASTA

1773 bp · LXL04_037572|LXL04_037572|OH1004|CDS

ATGTTCACCAAGTTCATGCTCCGACCACCTTGCTCCGTTTCAATTCCTCTCTCTCCGTCTCTTACACCCTTCTTCTCTAACCCCTGCACCGCCATCTCTATCCGTCGTAGTGCCGTCGTCTCCGCTGCAGCTTCCCTTTCTGTGACCCTCGACGAAACTCTCCCTTACGGACCTTCTTTATCCAAAGGCTACCAACCACCCTCTATAGAAACCAAATCGCCACAGCAAGATACCGAAATCTTTTTCGATGAAACTCGGTT...

Protein

Download Protein FASTA

590 aa · LXL04_037572|LXL04_037572|OH1004|PROTEIN

MFTKFMLRPPCSVSIPLSPSLTPFFSNPCTAISIRRSAVVSAAASLSVTLDETLPYGPSLSKGYQPPSIETKSPQQDTEIFFDETRFIRVFDISAIRVSADRCYALESQLRGHLLNWPRIRNIARVPGDEIDAELQKYFNSNDGEHEPLQFLNRRIYGKAEGDGEPLSPVLYRDKLAKTFNSRGFEKFRNLAKLSRPKRTTKKEPSRIRENKSNEYYLLEEVVNIHHDPENAHDLSGLLGDDEYRLGKWKGSTRLLLLDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037572`
TK1151 ID	TkA04G325090
OH-1004 ID	LXL04_037572
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037572

Location Chr09:15002580-15006842 (-)

Description Similar to VIT_19s0014g03930: tRNA (guanine(37)-N1)-methyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27340`	Specifically methylates the N1 position of guanosine-37 in various cytoplasmic and mitochondrial tRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037572 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002939 tRNA N1-guanine methylation Biological Process

GO:0070901 mitochondrial tRNA methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008175 tRNA methyltransferase activity Molecular Function

GO:0052906 tRNA (guanine(37)-N1)-methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G27340

dre:564078

pif:PITG_12867

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.374

Rank 1 · LXL04_037572 · OH-1004

Mitochondrion0.336

Rank 2 · LXL04_037572 · OH-1004

Nucleus0.173

Rank 3 · LXL04_037572 · OH-1004

Cytoplasm0.139

Rank 4 · LXL04_037572 · OH-1004

Peroxisome0.046

Rank 5 · LXL04_037572 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25133.2TYW2_N_2299-377 aa

PF02475.24TRM5-TYW2_MTfase381-515 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037572	`PF25133.2`	TYW2_N_2	299	377	3.6e-21	75.8
LXL04_037572	`PF02475.24`	TRM5-TYW2_MTfase	381	515	3.8e-30	105.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQ64`	Arabidopsis thaliana	tRNA (guanine(37)-N(1))-methyltransferase 2	61.043%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card