LXL04_036639 | RubberDandelionOmics

Gene overview

LXL04_036639

Reference: OH-1004 Chr: Chr08 Coordinates: 45816102-45820457 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2034 bp · LXL04_036639|LXL04_036639|OH1004|cDNA

ATGGCGGAAGTGCATTCGACTTCGTCGTCTACGGCCGCAAAACCAGCGACTAGCCCCGATCCCGAAGCGATTCCCAACGAGAAATGGGTCGCCGGCGAAGACCCGATTCTTCAGGTGTTGAATTGTGTATACCCTACATTGGATTCGGAAGAGAAGAGGAAAGACGTGATTGAATTCATGCAGAAGCTCATCAGAAGTTCACTCGGAGTTGAGGTGTTCCCATATGGTTCAACACCACTCAAGACTTATCTCCCTGATGG...

CDS

Download CDS FASTA

2034 bp · LXL04_036639|LXL04_036639|OH1004|CDS

ATGGCGGAAGTGCATTCGACTTCGTCGTCTACGGCCGCAAAACCAGCGACTAGCCCCGATCCCGAAGCGATTCCCAACGAGAAATGGGTCGCCGGCGAAGACCCGATTCTTCAGGTGTTGAATTGTGTATACCCTACATTGGATTCGGAAGAGAAGAGGAAAGACGTGATTGAATTCATGCAGAAGCTCATCAGAAGTTCACTCGGAGTTGAGGTGTTCCCATATGGTTCAACACCACTCAAGACTTATCTCCCTGATGG...

Protein

Download Protein FASTA

677 aa · LXL04_036639|LXL04_036639|OH1004|PROTEIN

MAEVHSTSSSTAAKPATSPDPEAIPNEKWVAGEDPILQVLNCVYPTLDSEEKRKDVIEFMQKLIRSSLGVEVFPYGSTPLKTYLPDGDIDFTAIGPPGRGNILPHDVLHLLQAQEYYGNNEFEIRDVTFIDAEVKLVKCIVSGIVIDISFNMLGGLCTLCFLEQVDRHIGNDHIFKRSIILIKTWCFYESRLLGANYGLLSTYALAVLVLYIFQVFGASITSPLMALYRFLDYYSKFDWDNYCINLNGVVNKSSLPDIVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036639`
TK1151 ID	TkA04G032890
OH-1004 ID	LXL04_036639
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036639

Location Chr08:45816102-45820457 (-)

Description Similar to HESO1: Protein HESO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39740`	Uridylates small RNAs to trigger their degradation.	Uridylation of miRNAs by hen1 suppressor1 in Arabidopsis.2012 · DOI: 10.1016/j.cub.2012.02.052 The Arabidopsis nucleotidyl transferase HESO1 uridylates unmethylated small RNAs to trigger their degradation.2012 · DOI: 10.1016/j.cub.2012.02.051 Methylation protects microRNAs from an AGO1-associated activity that uridylates 5' RNA fragments generated by AGO1 cleavage.2014 · DOI: 10.1073/pnas.1405083111 Synergistic and independent actions of multiple terminal nucleotidyl transferases in the 3' tailing of small RNAs in Arabidopsis.2015 · DOI: 10.1371/journal.pgen.1005091 Distinct and cooperative activities of HESO1 and URT1 nucleotidyl transferases in microRNA turnover in Arabidopsis.2015 · DOI: 10.1371/journal.pgen.1005119

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036639 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0010587 miRNA catabolic process Biological Process

GO:0016077 sno(s)RNA catabolic process Biological Process

GO:0031123 RNA 3'-end processing Biological Process

GO:0034475 U4 snRNA 3'-end processing Biological Process

GO:0043634 polyadenylation-dependent ncRNA catabolic process Biological Process

GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process Biological Process

GO:0071038 TRAMP-dependent tRNA surveillance pathway Biological Process

GO:0071040 nuclear polyadenylation-dependent antisense transcript catabolic process Biological Process

GO:0140746 siRNA catabolic process Biological Process

GO:1990431 priRNA 3'-end processing Biological Process

GO:0000932 P-body Cellular Component

KEGG gene cross-reference

ath:AT2G39740

spo:3361384

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.616

Rank 1 · LXL04_036639 · OH-1004

Nucleus0.355

Rank 2 · LXL04_036639 · OH-1004

Cell membrane0.091

Rank 3 · LXL04_036639 · OH-1004

Endoplasmic reticulum0.066

Rank 4 · LXL04_036639 · OH-1004

Lysosome / Vacuole0.053

Rank 5 · LXL04_036639 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26180.1PAP-OAS1169-361 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036639	`PF26180.1`	PAP-OAS1	169	361	1.1e-84	283.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XET5`	Arabidopsis thaliana	Protein HESO1	24.011%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card