LXL04_036375 | RubberDandelionOmics

Gene overview

LXL04_036375

Reference: OH-1004 Chr: Chr08 Coordinates: 41041707-41043573 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

912 bp · LXL04_036375|LXL04_036375|OH1004|cDNA

ATGGCGGATATCAGCCATCGCACTGAGATCTCCTTTGCCGGGACCTTCATCTGCAGCGCCTTCGCCGCCTGTTTTGCAGAGTTATGTACAATTCCTCTAGACACTGCTAAAGTTCGACTTCAACTCCAGAAGAGATCAGTATCAGGAGAAAGCGGTGCTGGTGGATCCAAGTACAAGGGTCTATTAGGTACAGTTGCTACCATAGCCAAGGAAGAAGGTTTACTTGCACTTTGGAAAGGTATTATACCTGGATTACATCG...

CDS

Download CDS FASTA

912 bp · LXL04_036375|LXL04_036375|OH1004|CDS

ATGGCGGATATCAGCCATCGCACTGAGATCTCCTTTGCCGGGACCTTCATCTGCAGCGCCTTCGCCGCCTGTTTTGCAGAGTTATGTACAATTCCTCTAGACACTGCTAAAGTTCGACTTCAACTCCAGAAGAGATCAGTATCAGGAGAAAGCGGTGCTGGTGGATCCAAGTACAAGGGTCTATTAGGTACAGTTGCTACCATAGCCAAGGAAGAAGGTTTACTTGCACTTTGGAAAGGTATTATACCTGGATTACATCG...

Protein

Download Protein FASTA

303 aa · LXL04_036375|LXL04_036375|OH1004|PROTEIN

MADISHRTEISFAGTFICSAFAACFAELCTIPLDTAKVRLQLQKRSVSGESGAGGSKYKGLLGTVATIAKEEGLLALWKGIIPGLHRQFIYGGLRIGLYEPVKAFCSGGILLEDVSLFQKIIAALITGAIAISFANPTDLVKVRLQAEGKLPAGAPRRYSGALNAYYTIIKEDGVIALWTGLGPNIARNAIINAAELASYDQVKQSVMKIPGFTDNIFTHLLAGLGAGFFAVLIGSPVDVVKSRMMGDSIYKSTFDCIVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036375`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036375

Location Chr08:41041707-41043573 (-)

Description Similar to PUMP2: Mitochondrial uncoupling protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58970`	PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation.	No verified direct reference in this release
`At3g54110`	PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation.	Functional reconstitution of Arabidopsis thaliana plant uncoupling mitochondrial protein (AtPUMP1) expressed in Escherichia coli.2001 · DOI: 10.1016/s0014-5793(01)02835-6 Overexpression of plant uncoupling mitochondrial protein in transgenic tobacco increases tolerance to oxidative stress.2003 · DOI: 10.1023/a:1024603530043 Mitochondrial uncoupling protein is required for efficient photosynthesis.2006 · DOI: 10.1073/pnas.0607751103 Mutational analysis of Arabidopsis thaliana plant uncoupling mitochondrial protein.2007 · DOI: 10.1016/j.bbabio.2007.09.005 An Arabidopsis mitochondrial uncoupling protein confers tolerance to drought and salt stress in transgenic tobacco plants.2011 · DOI: 10.1371/journal.pone.0023776

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036375 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0009853 photorespiration Biological Process

GO:0015979 photosynthesis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1990542 mitochondrial transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G54110

ath:AT5G58970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.850

Rank 1 · LXL04_036375 · OH-1004

Cytoplasm0.029

Rank 2 · LXL04_036375 · OH-1004

Plastid0.024

Rank 3 · LXL04_036375 · OH-1004

Peroxisome0.020

Rank 4 · LXL04_036375 · OH-1004

Cell membrane0.018

Rank 5 · LXL04_036375 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153.33Mito_carr10-106 aa

PF00153.33Mito_carr115-209 aa

PF00153.33Mito_carr215-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036375	`PF00153.33`	Mito_carr	10	106	1.9e-68	227.0
LXL04_036375	`PF00153.33`	Mito_carr	115	209	1.9e-68	227.0
LXL04_036375	`PF00153.33`	Mito_carr	215	301	1.9e-68	227.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZWG1`	Arabidopsis thaliana	Mitochondrial uncoupling protein 2	72.517%	Swiss-Prot	strong database homology
`O81845`	Arabidopsis thaliana	Mitochondrial uncoupling protein 1	71.380%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card