LXL04_036208 | RubberDandelionOmics

Gene overview

LXL04_036208

Reference: OH-1004 Chr: Chr08 Coordinates: 37974494-37975917 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1134 bp · LXL04_036208|LXL04_036208|OH1004|cDNA

ATGGCAGATGGAGAGGATATTCAGCCACTCGTTTGCGATAATGGAACTGGAATGGTTAAGGCTGGATTCGCTGGAGACGATGCACCACGAGCTGTTTTCCCTAGCATCGTCGGACGTCCACGTCACACCGGAGTGATGGTCGGCATGGGACAAAAAGACGCTTACGTCGGCGACGAAGCTCAATCCAAAAGAGGTATTCTAACTCTAAAATACCCAATCGAACACGGAATCGTCAACAACTGGGACGACATGGAAAAAAT...

CDS

Download CDS FASTA

1134 bp · LXL04_036208|LXL04_036208|OH1004|CDS

ATGGCAGATGGAGAGGATATTCAGCCACTCGTTTGCGATAATGGAACTGGAATGGTTAAGGCTGGATTCGCTGGAGACGATGCACCACGAGCTGTTTTCCCTAGCATCGTCGGACGTCCACGTCACACCGGAGTGATGGTCGGCATGGGACAAAAAGACGCTTACGTCGGCGACGAAGCTCAATCCAAAAGAGGTATTCTAACTCTAAAATACCCAATCGAACACGGAATCGTCAACAACTGGGACGACATGGAAAAAAT...

Protein

Download Protein FASTA

377 aa · LXL04_036208|LXL04_036208|OH1004|PROTEIN

MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTSAEREIVRDMKEKLAYIALDFEQELETSKTSSAVEKSFELPDGQVITIGAERFRCP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036208`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036208

Location Chr08:37974494-37975917 (-)

Description Similar to Actin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53750`	Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.	No verified direct reference in this release
`At2g37620`	Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.	No verified direct reference in this release
`At5g59370`	Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036208 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048589 developmental growth Biological Process

GO:0048767 root hair elongation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

KEGG gene cross-reference

ath:AT2G37620

ath:AT3G53750

ath:AT5G59370

ghi:107932458

ghi:107953109

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.704

Rank 1 · LXL04_036208 · OH-1004

Nucleus0.283

Rank 2 · LXL04_036208 · OH-1004

Cell membrane0.178

Rank 3 · LXL04_036208 · OH-1004

Mitochondrion0.065

Rank 4 · LXL04_036208 · OH-1004

Golgi apparatus0.047

Rank 5 · LXL04_036208 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00022.27Actin5-377 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036208	`PF00022.27`	Actin	5	377	5e-147	490.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0CJ47`	Arabidopsis thaliana	Actin-3	96.817%	Swiss-Prot	strong database homology
`P0CJ46`	Arabidopsis thaliana	Actin-1	96.817%	Swiss-Prot	strong database homology
`P53494`	Arabidopsis thaliana	Actin-4	97.613%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card