LXL04_036190 | RubberDandelionOmics

Gene overview

LXL04_036190

Reference: OH-1004 Chr: Chr08 Coordinates: 37764082-37766046 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

702 bp · LXL04_036190|LXL04_036190|OH1004|cDNA

ATGGCCGGAACTGCTTCATCTGCTAAAAGATGGCTTCCGCTCGAAGCCAACCCTGATGTTATGAACCAGTTTCTTTGGCGTCTTGGTGTTGTTCCTGGTGAGGCTGAATGCAGTGATGTATATGGATTGGATGAAGAACTCTTGGCAATGGTCCCACAGCCAGTTCTTGCTGTGTTGTTTCTTTACCCAATCACACCACAGAGTGAAGAAGAAAGATTAAAGCAGAACGATATCAAACAGGGTCCTTCTGATGGGGTTTA...

CDS

Download CDS FASTA

702 bp · LXL04_036190|LXL04_036190|OH1004|CDS

ATGGCCGGAACTGCTTCATCTGCTAAAAGATGGCTTCCGCTCGAAGCCAACCCTGATGTTATGAACCAGTTTCTTTGGCGTCTTGGTGTTGTTCCTGGTGAGGCTGAATGCAGTGATGTATATGGATTGGATGAAGAACTCTTGGCAATGGTCCCACAGCCAGTTCTTGCTGTGTTGTTTCTTTACCCAATCACACCACAGAGTGAAGAAGAAAGATTAAAGCAGAACGATATCAAACAGGGTCCTTCTGATGGGGTTTA...

Protein

Download Protein FASTA

233 aa · LXL04_036190|LXL04_036190|OH1004|PROTEIN

MAGTASSAKRWLPLEANPDVMNQFLWRLGVVPGEAECSDVYGLDEELLAMVPQPVLAVLFLYPITPQSEEERLKQNDIKQGPSDGVYFMRQTVGNACGTVGLLHAVGNLTSEIKLDEGSFLEKFFKTTANMEPMEIARYLEKDTEMEVAHSEAVAAGETEANDNVNDHFICFVCVNGQLYELDGRRNAPLSHGPSSPNTVLQDAAKVIKGMIAKNPDSMNFSVIAISKKVGDY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036190`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036190

Location Chr08:37764082-37766046 (+)

Description Similar to UCH3: Ubiquitin carboxyl-terminal hydrolase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17510`	Ubiquitin carboxyl-terminal hydrolase 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036190 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0032869 cellular response to insulin stimulus Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004843 cysteine-type deubiquitinase activity Molecular Function

GO:0008233 peptidase activity Molecular Function

GO:0019784 deNEDDylase activity Molecular Function

GO:0043130 ubiquitin binding Molecular Function

KEGG gene cross-reference

ath:AT4G17510

bta:520170

hsa:7347

rno:498560

ssc:768115

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.666

Rank 1 · LXL04_036190 · OH-1004

Nucleus0.493

Rank 2 · LXL04_036190 · OH-1004

Mitochondrion0.105

Rank 3 · LXL04_036190 · OH-1004

Cell membrane0.070

Rank 4 · LXL04_036190 · OH-1004

Endoplasmic reticulum0.058

Rank 5 · LXL04_036190 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01088.28Peptidase_C1211-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036190	`PF01088.28`	Peptidase_C12	11	212	8.9e-67	225.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWE1`	Arabidopsis thaliana	Ubiquitin carboxyl-terminal hydrolase 3	67.532%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card