LXL04_035348 | RubberDandelionOmics

Gene overview

LXL04_035348

Reference: OH-1004 Chr: Chr08 Coordinates: 20746868-20758190 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1056 bp · LXL04_035348|LXL04_035348|OH1004|cDNA

ATGGCTATGATTATTTGCAAGCTATTTACTGTCTGTCAACATTCGGGGGAAGTCTTGACTACTCCGGATAACCACGATACTCGAAGTTCGGGAATCACATCTTCAAATAATAAGAAAGAGCTTAAGCCAAACGGACAACATGGTCTTCTAGATGGCTATTGTAACACATGGTATGCGTTCATTTCGGTGttcgcgtactggagtgatgatggTCCTTCGGTCGTGGCCTGTACAAACATCACGTGGAATAGGAGGATACT...

CDS

Download CDS FASTA

1056 bp · LXL04_035348|LXL04_035348|OH1004|CDS

ATGGCTATGATTATTTGCAAGCTATTTACTGTCTGTCAACATTCGGGGGAAGTCTTGACTACTCCGGATAACCACGATACTCGAAGTTCGGGAATCACATCTTCAAATAATAAGAAAGAGCTTAAGCCAAACGGACAACATGGTCTTCTAGATGGCTATTGTAACACATGGTATGCGTTCATTTCGGTGTTCGCGTACTGGAGTGATGATGGTCCTTCGGTCGTGGCCTGTACAAACATCACGTGGAATAGGAGGATACT...

Protein

Download Protein FASTA

351 aa · LXL04_035348|LXL04_035348|OH1004|PROTEIN

MAMIICKLFTVCQHSGEVLTTPDNHDTRSSGITSSNNKKELKPNGQHGLLDGYCNTWYAFISVFAYWSDDGPSVVACTNITWNRRILAPAAYIFFSSTLPVIAFGEQHRRDTGTEMTLNRDSKGSFVPKADIFPSGIKHITNMHQANSWIIRILEETQKFGNKLSQQLDFSHRVHGVGDDVGLIGFRRKSLYSPDVLNGLKPPGLPLHRLILKVGIPVMLLRNLDQKAVVAVSDGLKAWEVLKGKSQHIDLILTEVELPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035348`
TK1151 ID	TkA05G140230
OH-1004 ID	LXL04_035348
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	62.500
Protein coverage (%)	TK1151 28.743 / OH-1004 13.675 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035348

Location Chr08:20746868-20758190 (+)

Description Similar to APRR5: Two-component response regulator-like APRR5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24470`	Transcriptional repressor of CCA1 and LHY, thereby controlling photoperiodic flowering response.	Circadian waves of expression of the APRR1/TOC1 family of pseudo-response regulators in Arabidopsis thaliana: insight into the plant circadian clock.2000 · DOI: 10.1093/pcp/pcd043
`At2g46790`	Transcriptional repressor of CCA1 and LHY, and positive regulator of LWD1 and LWD2 expression.	Circadian waves of expression of the APRR1/TOC1 family of pseudo-response regulators in Arabidopsis thaliana: insight into the plant circadian clock.2000 · DOI: 10.1093/pcp/pcd043

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0532400`	Controls photoperiodic flowering response.	No verified direct reference in this release
`UniProt: A2XFB7`	Controls photoperiodic flowering response.	No verified direct reference in this release
`Os03g0284100`	Controls photoperiodic flowering response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035348 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010114 response to red light Biological Process

GO:0010218 response to far red light Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048511 rhythmic process Biological Process

GO:0051170 import into nucleus Biological Process

KEGG gene cross-reference

ath:AT2G46790

ath:AT5G24470

dosa:Os03g0284100

dosa:Os09g0532400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.506

Rank 1 · LXL04_035348 · OH-1004

Cytoplasm0.353

Rank 2 · LXL04_035348 · OH-1004

Mitochondrion0.109

Rank 3 · LXL04_035348 · OH-1004

Cell membrane0.072

Rank 4 · LXL04_035348 · OH-1004

Endoplasmic reticulum0.063

Rank 5 · LXL04_035348 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21530.4Pif1_2B_dom197-227 aa

PF00072.31Response_reg220-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035348	`PF21530.4`	Pif1_2B_dom	197	227	1.9e-10	41.0
LXL04_035348	`PF00072.31`	Response_reg	220	285	1.1e-06	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6LA42`	Arabidopsis thaliana	Two-component response regulator-like APRR5	55.952%	Swiss-Prot	weak database homology
`Q8L500`	Arabidopsis thaliana	Two-component response regulator-like APRR9	69.697%	Swiss-Prot	weak database homology
`Q689G6`	Oryza sativa subsp. japonica	Two-component response regulator-like PRR95	33.000%	Swiss-Prot	weak database homology
`A2XFB7`	Oryza sativa subsp. indica	Two-component response regulator-like PRR73	49.057%	Swiss-Prot	weak database homology
`Q10N34`	Oryza sativa subsp. japonica	Two-component response regulator-like PRR73	49.057%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card