LXL04_034589 | RubberDandelionOmics

Gene overview

LXL04_034589

Reference: OH-1004 Chr: Chr07 Coordinates: 108440406-108443357 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

942 bp · LXL04_034589|LXL04_034589|OH1004|cDNA

ATGGAAATAGAGAAATGTAATAGTATTGGAAAGCGAGGAAGACGATCGCCAAGCTGGCACTCATTTGGAAGCCATAGTTGGAGCTTTGAAGAAGTCTTTGTGACCACAAATCATAGCAGAAGCAACAGTCAtgctgaagaagatgaagaagctCTAAAACAGGCAGCCATGGAGAAACTGCCCGAATTTGATGAATTAAGAAGCACAGTTATCGAATCTTGTGTTGTAACAGAAATGGAAGAAAATACGGGAAAGATTGA...

CDS

Download CDS FASTA

942 bp · LXL04_034589|LXL04_034589|OH1004|CDS

ATGGAAATAGAGAAATGTAATAGTATTGGAAAGCGAGGAAGACGATCGCCAAGCTGGCACTCATTTGGAAGCCATAGTTGGAGCTTTGAAGAAGTCTTTGTGACCACAAATCATAGCAGAAGCAACAGTCATGCTGAAGAAGATGAAGAAGCTCTAAAACAGGCAGCCATGGAGAAACTGCCCGAATTTGATGAATTAAGAAGCACAGTTATCGAATCTTGTGTTGTAACAGAAATGGAAGAAAATACGGGAAAGATTGA...

Protein

Download Protein FASTA

313 aa · LXL04_034589|LXL04_034589|OH1004|PROTEIN

MEIEKCNSIGKRGRRSPSWHSFGSHSWSFEEVFVTTNHSRSNSHAEEDEEALKQAAMEKLPEFDELRSTVIESCVVTEMEENTGKIESQLLIEKLFNVVEEDNGKFLKKIRDRYDKAEVSVPTVEVRYEHLNVEADCFIGDRALPTLGNTLRNVADSALTFLGITLSQTTKLTILSDASGIISPSRMTLLLGPPSSGKTTLLQALAGKLDSSLKVEGKVTYNGHTLKEFVPQRTCAYVSQHDVHVAEMTVKETLDFSARC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034589`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034589

Location Chr07:108440406-108443357 (-)

Description Similar to ABCG29: ABC transporter G family member 29

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16340`	May be a general defense protein.	No verified direct reference in this release
`At1g59870`	Together with ABCG37, regulates auxin homeostasis and responses by playing a dual role in coumarin (e.g. esculin) and in the auxin precursor indole 3-butyric acid (IBA) efflux transport, thus influencing cotyledons, roots and root hairs development.	Loss of AtPDR8, a plasma membrane ABC transporter of Arabidopsis thaliana, causes hypersensitive cell death upon pathogen infection.2006 · DOI: 10.1093/pcp/pcj001 Arabidopsis PEN3/PDR8, an ATP binding cassette transporter, contributes to nonhost resistance to inappropriate pathogens that enter by direct penetration.2006 · DOI: 10.1105/tpc.105.038372 The ABC transporter AtPDR8 is a cadmium extrusion pump conferring heavy metal resistance.2007 · DOI: 10.1111/j.1365-313x.2007.03044.x Extracellular transport and integration of plant secretory proteins into pathogen-induced cell wall compartments.2009 · DOI: 10.1111/j.1365-313x.2008.03743.x Glucosinolate metabolites required for an Arabidopsis innate immune response.2009 · DOI: 10.1126/science.1164627 The Arabidopsis PLEIOTROPIC DRUG RESISTANCE8/ABCG36 ATP binding cassette transporter modulates sensitivity to the auxin precursor indole-3-butyric acid.2009 · DOI: 10.1105/tpc.109.065821 Overexpression of AtABCG36 improves drought and salt stress resistance in Arabidopsis.2010 · DOI: 10.1111/j.1399-3054.2010.01353.x Arabidopsis PIS1 encodes the ABCG37 transporter of auxinic compounds including the auxin precursor indole-3-butyric acid.2010 · DOI: 10.1073/pnas.1005878107 Induction and suppression of PEN3 focal accumulation during Pseudomonas syringae pv. tomato DC3000 infection of Arabidopsis.2013 · DOI: 10.1094/mpmi-11-12-0262-r Role of the penetration-resistance genes PEN1, PEN2 and PEN3 in the hypersensitive response and race-specific resistance in Arabidopsis thaliana.2014 · DOI: 10.1111/tpj.12571 Mutant Allele-Specific Uncoupling of PENETRATION3 Functions Reveals Engagement of the ATP-Binding Cassette Transporter in Distinct Tryptophan Metabolic Pathways.2015 · DOI: 10.1104/pp.15.00182 ABC transporter PEN3/PDR8/ABCG36 interacts with calmodulin that, like PEN3, is required for Arabidopsis nonhost resistance.2016 · DOI: 10.1111/nph.13582 An Arabidopsis Lipid Flippase Is Required for Timely Recruitment of Defenses to the Host-Pathogen Interface at the Plant Cell Surface.2017 · DOI: 10.1016/j.molp.2017.04.003 Arabidopsis Transporter ABCG37/PDR9 contributes primarily highly oxygenated Coumarins to Root Exudation.2017 · DOI: 10.1038/s41598-017-03250-6 Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation.2018 · DOI: 10.1007/s10265-017-0979-4 Arabidopsis BTB/POZ protein-dependent PENETRATION3 trafficking and disease susceptibility.2017 · DOI: 10.1038/s41477-017-0039-z
`At1g15210`	May be a general defense protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0554800`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034589 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0002239 response to oomycetes Biological Process

GO:0002240 response to molecule of oomycetes origin Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009651 response to salt stress Biological Process

KEGG gene cross-reference

ath:AT1G15210

ath:AT1G59870

ath:AT3G16340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.479

Rank 1 · LXL04_034589 · OH-1004

Cytoplasm0.294

Rank 2 · LXL04_034589 · OH-1004

Nucleus0.203

Rank 3 · LXL04_034589 · OH-1004

Endoplasmic reticulum0.078

Rank 4 · LXL04_034589 · OH-1004

Golgi apparatus0.064

Rank 5 · LXL04_034589 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14510.12ABC_trans_N100-149 aa

PF00005.34ABC_tran176-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034589	`PF14510.12`	ABC_trans_N	100	149	7e-07	30.3
LXL04_034589	`PF00005.34`	ABC_tran	176	277	7.4e-11	43.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A18`	Arabidopsis thaliana	ABC transporter G family member 29	60.563%	Swiss-Prot	strong database homology
`Q9XIE2`	Arabidopsis thaliana	ABC transporter G family member 36	52.560%	Swiss-Prot	strong database homology
`Q7PC86`	Arabidopsis thaliana	ABC transporter G family member 35	53.199%	Swiss-Prot	strong database homology
`Q5Z9S8`	Oryza sativa subsp. japonica	ABC transporter G family member 42	48.955%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card