LXL04_034512 | RubberDandelionOmics

Gene overview

LXL04_034512

Reference: OH-1004 Chr: Chr07 Coordinates: 103483208-103489286 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1802 bp · LXL04_034512|LXL04_034512|OH1004|cDNA

GTGACCAACaaggaaaaaaaaaagtaattCGGCCCCAACAAGGATTCACACAAACAGACCTTCGCAAGATCTCGCACACACCAAACAAAATTTCACTACCATCTCAATCTCGACTGATGCCCACAAGTACCTCCGCCTCCGCTGCGGCGGCTAGTATATCCCCAGCTGCCTCCGACTCTGATGAATACGAGTACGAGGAAATAGAAGTAGAAGAAGAGGTAGAAGTAGAAGAAGAAGTCTCCGACGAAGAAGTCaatgag...

CDS

Download CDS FASTA

1689 bp · LXL04_034512|LXL04_034512|OH1004|CDS

CTGATGCCCACAAGTACCTCCGCCTCCGCTGCGGCGGCTAGTATATCCCCAGCTGCCTCCGACTCTGATGAATACGAGTACGAGGAAATAGAAGTAGAAGAAGAGGTAGAAGTAGAAGAAGAAGTCTCCGACGAAGAAGTCAATGAGGAAGAAGAAGAAGAAGAAGAAGAAGGAGAAGAAGAAGAAGAAGGCGAAGACGAAGAAGAAGAAGAACATATATCGCCACCAATTGACGAGAAAGATCACGAGAAAGGAAAAAT...

Protein

Download Protein FASTA

562 aa · LXL04_034512|LXL04_034512|OH1004|PROTEIN

MMPTSTSASAAAASISPAASDSDEYEYEEIEVEEEVEVEEEVSDEEVNEEEEEEEEEGEEEEEGEDEEEEEHISPPIDEKDHEKGKITTVDDGDKSSQPDDDGGVTTSNPVGVSDKGVKVSGESVIEGGLNEHNHPPLPSPSPIEKETKGTNEDNCPPSEKESKGTNEDNLLPSEKLTNETKDQDNKHQKQDGVSVRLDRRPRSLSPGKKGNIKKRQVLVCQFFAKGWCIKGNSCKFLHIKEPKDKNKQQDSRSNSTPVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034512`
TK1151 ID	TkA08G406210
OH-1004 ID	LXL04_034512
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.900
Protein coverage (%)	TK1151 80.782 / OH-1004 87.544 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034512

Location Chr07:103483208-103489286 (+)

Description Similar to FES1: Protein FRIGIDA-ESSENTIAL 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33835`	Transcriptional activator involved in the FRIGIDA-mediated vernalization pathway, but not in the autonomous flowering pathway.	FRIGIDA-ESSENTIAL 1 interacts genetically with FRIGIDA and FRIGIDA-LIKE 1 to promote the winter-annual habit of Arabidopsis thaliana.2005 · DOI: 10.1242/dev.02170 The FRIGIDA complex activates transcription of FLC, a strong flowering repressor in Arabidopsis, by recruiting chromatin modification factors.2011 · DOI: 10.1105/tpc.110.075911
`At3g18640`	Zinc finger CCCH domain-containing protein 38.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0135800`	Zinc finger CCCH domain-containing protein 55.	No verified direct reference in this release
`Os05g0497500`	Zinc finger CCCH domain-containing protein 36.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034512 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009908 flower development Biological Process

GO:0010220 positive regulation of vernalization response Biological Process

GO:0030154 cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G33835

ath:AT3G18640

dosa:Os05g0497500

dosa:Os08g0135800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.921

Rank 1 · LXL04_034512 · OH-1004

Cytoplasm0.124

Rank 2 · LXL04_034512 · OH-1004

Cell membrane0.059

Rank 3 · LXL04_034512 · OH-1004

Endoplasmic reticulum0.039

Rank 4 · LXL04_034512 · OH-1004

Plastid0.015

Rank 5 · LXL04_034512 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16131.12Torus184-247 aa

PF18345.8zf_CCCH_4221-239 aa

PF23030.2SCAF11-like_C483-526 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034512	`PF16131.12`	Torus	184	247	6.1e-07	30.7
LXL04_034512	`PF18345.8`	zf_CCCH_4	221	239	7.7e-06	26.5
LXL04_034512	`PF23030.2`	SCAF11-like_C	483	526	3.2e-06	27.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84VG7`	Arabidopsis thaliana	Protein FRIGIDA-ESSENTIAL 1	32.971%	Swiss-Prot	weak database homology
`Q9LIH5`	Arabidopsis thaliana	Zinc finger CCCH domain-containing protein 38	48.864%	Swiss-Prot	weak database homology
`Q6YYC0`	Oryza sativa subsp. japonica	Zinc finger CCCH domain-containing protein 55	47.826%	Swiss-Prot	weak database homology
`Q75K81`	Oryza sativa subsp. japonica	Zinc finger CCCH domain-containing protein 36	51.316%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card