LXL04_032876 | RubberDandelionOmics

Gene overview

LXL04_032876

Reference: OH-1004 Chr: Chr07 Coordinates: 30925745-30926077 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

333 bp · LXL04_032876|LXL04_032876|OH1004|cDNA

ATGACCTTTTTGGCCGGAACCACCGTCGAGTACATGCGTCCAAGGGTGTTTTTCGCAGCGGCGGTGATCGGCGTCCACACCGGCGTCGACGACTTTCTCTACGCCTGCGGAATCATCCGCCTCCCTGTGTTGTATTCGATCACGGCGGTGATCGGCGTCCTCACCGGCGTCGCGTTTCTGTTGGTGAAACAGAAATTCACGCCGTATTCGATCACGTCGTTGTATGGACTGGTGTTGCCGATGGTGGAGATGACGTATAA...

CDS

Download CDS FASTA

333 bp · LXL04_032876|LXL04_032876|OH1004|CDS

ATGACCTTTTTGGCCGGAACCACCGTCGAGTACATGCGTCCAAGGGTGTTTTTCGCAGCGGCGGTGATCGGCGTCCACACCGGCGTCGACGACTTTCTCTACGCCTGCGGAATCATCCGCCTCCCTGTGTTGTATTCGATCACGGCGGTGATCGGCGTCCTCACCGGCGTCGCGTTTCTGTTGGTGAAACAGAAATTCACGCCGTATTCGATCACGTCGTTGTATGGACTGGTGTTGCCGATGGTGGAGATGACGTATAA...

Protein

Download Protein FASTA

110 aa · LXL04_032876|LXL04_032876|OH1004|PROTEIN

MTFLAGTTVEYMRPRVFFAAAVIGVHTGVDDFLYACGIIRLPVLYSITAVIGVLTGVAFLLVKQKFTPYSITSLYGLVLPMVEMTYNKTKQAITYTPVTNSGQKGHMRTI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032876`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032876

Location Chr07:30925745-30926077 (+)

Description Similar to PUP2: Purine permease 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33750`	Mediates adenine transport.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x
`At1g28230`	Proton-coupled purine transporter mediating adenine and trans-zeatin uptake.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x Recycling of pyridoxine (vitamin B6) by PUP1 in Arabidopsis.2013 · DOI: 10.1111/tpj.12195
`At1g28220`	May be involved in transport of purine derivatives during pollen germination and tube elongation.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032876 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006863 purine nucleobase transport Biological Process

GO:0010184 cytokinin transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005345 purine nucleobase transmembrane transporter activity Molecular Function

GO:0015211 purine nucleoside transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G28220

ath:AT1G28230

ath:AT2G33750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.278

Rank 1 · LXL04_032876 · OH-1004

Mitochondrion0.236

Rank 2 · LXL04_032876 · OH-1004

Endoplasmic reticulum0.185

Rank 3 · LXL04_032876 · OH-1004

Nucleus0.166

Rank 4 · LXL04_032876 · OH-1004

Extracellular0.127

Rank 5 · LXL04_032876 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16913.12PUNUT10-74 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032876	`PF16913.12`	PUNUT	10	74	1.1e-08	35.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94GB1`	Arabidopsis thaliana	Purine permease 2	32.031%	Swiss-Prot	moderate database homology
`Q9FZ96`	Arabidopsis thaliana	Purine permease 1	33.594%	Swiss-Prot	moderate database homology
`Q9FZ95`	Arabidopsis thaliana	Purine permease 3	28.148%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card