Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1233 bp · LXL04_032841|LXL04_032841|OH1004|cDNA
ATGGGGAATGCTCAGTCACCTGCCGCCGATCCTCGTTTCACCTCGGCTTCCAGAGCTTTCTCTGAGAAGGAGCTAGGTGACCTAAGATCGTTGTTCGAATCTCTCGTTTCTCAGTCTCAAACCGATAGAAAATACGTCTCGCTCTCTGTATTCAAGGCGTATACCGGAATTACTGGTCGTCTCGGTGACAGACTGTATGATATAGTTACTCAAAACCGGAAAGATCAAAAGCTCACTTTTGCAGACCTTGTAATTGCTAA...
1233 bp · LXL04_032841|LXL04_032841|OH1004|CDS
ATGGGGAATGCTCAGTCACCTGCCGCCGATCCTCGTTTCACCTCGGCTTCCAGAGCTTTCTCTGAGAAGGAGCTAGGTGACCTAAGATCGTTGTTCGAATCTCTCGTTTCTCAGTCTCAAACCGATAGAAAATACGTCTCGCTCTCTGTATTCAAGGCGTATACCGGAATTACTGGTCGTCTCGGTGACAGACTGTATGATATAGTTACTCAAAACCGGAAAGATCAAAAGCTCACTTTTGCAGACCTTGTAATTGCTAA...
Protein
Download Protein FASTA410 aa · LXL04_032841|LXL04_032841|OH1004|PROTEIN
MGNAQSPAADPRFTSASRAFSEKELGDLRSLFESLVSQSQTDRKYVSLSVFKAYTGITGRLGDRLYDIVTQNRKDQKLTFADLVIAKGTYEKGTRDEIDEFLYQLCDIDGDGNLVRSDLESVITEILDTISSHKNTEPSSITIFLNAANFTKEGTSEKTMSIEDFKTWCRLVPSARKFLTKLLKPSSPGSQVPQLIHQDIDSNILLLKEEYAWHIGGALSHQELGEWKLLYHSALNGLSFNTFLGNISHAEGPTVLIIKD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_032841 |
|---|---|
| TK1151 ID | TkA08G208660 |
| OH-1004 ID | LXL04_032841 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 98.400 |
| Protein coverage (%) | TK1151 98.805 / OH-1004 60.488Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_032841 |
|---|---|
| Location | Chr07:30276218-30277927 (+) |
| Description | Similar to Meak7: MTOR-associated protein MEAK7 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006979 response to oxidative stress Biological Process GO:0030334 regulation of cell migration Biological Process GO:0031667 response to nutrient levels Biological Process GO:0031929 TOR signaling Biological Process GO:0032868 response to insulin Biological Process GO:0042127 regulation of cell population proliferation Biological Process GO:0043200 response to amino acid Biological Process GO:0150032 positive regulation of protein localization to lysosome Biological Process GO:1900408 negative regulation of cellular response to oxidative stress Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component |
| KEGG gene cross-reference | dre:561678 gga:415815 hsa:57707 mmu:74347 xla:446554 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07534.23TLD206-372 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_032841 | PF07534.23 | TLD | 206 | 372 | 1.4e-40 | 139.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.