LXL04_032746 | RubberDandelionOmics

Gene overview

LXL04_032746

Reference: OH-1004 Chr: Chr07 Coordinates: 28957048-28962096 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2865 bp · LXL04_032746|LXL04_032746|OH1004|cDNA

ATGGCAACTTTCGCCAAACCCGAAAATGCTTTAAAGCGAGCCGAAGAGTTGATCAATGTTGGACAAAAACAAGATGCATTACAAGCCCTTCACGGGATCATAACCTCAAAAAGATACAGAGCATGGCAAAAAACACTAGAACGCATCATGTTCAAATACGTAGAGCTATGTGTCGACATGAGAAGAGGTAGATTCGCAAAAGATGGCTTAATTCAGTATCGTATAATTTGTCAACAAGTCAACATAAGTTCATTGGAGGA...

CDS

Download CDS FASTA

2865 bp · LXL04_032746|LXL04_032746|OH1004|CDS

ATGGCAACTTTCGCCAAACCCGAAAATGCTTTAAAGCGAGCCGAAGAGTTGATCAATGTTGGACAAAAACAAGATGCATTACAAGCCCTTCACGGGATCATAACCTCAAAAAGATACAGAGCATGGCAAAAAACACTAGAACGCATCATGTTCAAATACGTAGAGCTATGTGTCGACATGAGAAGAGGTAGATTCGCAAAAGATGGCTTAATTCAGTATCGTATAATTTGTCAACAAGTCAACATAAGTTCATTGGAGGA...

Protein

Download Protein FASTA

954 aa · LXL04_032746|LXL04_032746|OH1004|PROTEIN

MATFAKPENALKRAEELINVGQKQDALQALHGIITSKRYRAWQKTLERIMFKYVELCVDMRRGRFAKDGLIQYRIICQQVNISSLEEVIKHFLHLATEKAEHARSQAQVLEDALDFDDLEADKRPEDLMLSYVSGEKGKDRSDRERVTPWFKLLWETYRTVLEILRNNSKLEALYAMTAHRAFQFCKQYKRTTEFRRLCEIIRNHLANHNKYRDQRDRPDLSAPESLQLYLDTRFEQLKVATELQLWQEAFRSVEDIYGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032746`
TK1151 ID	TkA08G203080
OH-1004 ID	LXL04_032746
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 64.256 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032746

Location Chr07:28957048-28962096 (+)

Description Similar to TIF3A1: Eukaryotic translation initiation factor 3 subunit A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11420`	RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032746 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001732 formation of cytoplasmic translation initiation complex Biological Process

GO:0002188 translation reinitiation Biological Process

GO:0006413 translational initiation Biological Process

GO:0070373 negative regulation of ERK1 and ERK2 cascade Biological Process

GO:0075522 IRES-dependent viral translational initiation Biological Process

GO:0075525 viral translational termination-reinitiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005813 centrosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005852 eukaryotic translation initiation factor 3 complex Cellular Component

KEGG gene cross-reference

ath:AT4G11420

mmu:13669

nta:107760201

rno:292148

zma:542747

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.637

Rank 1 · LXL04_032746 · OH-1004

Nucleus0.231

Rank 2 · LXL04_032746 · OH-1004

Cell membrane0.100

Rank 3 · LXL04_032746 · OH-1004

Golgi apparatus0.100

Rank 4 · LXL04_032746 · OH-1004

Lysosome / Vacuole0.061

Rank 5 · LXL04_032746 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22591.3eIF3a_PCI_TPR-like8-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032746	`PF22591.3`	eIF3a_PCI_TPR-like	8	408	1.3e-133	446.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD55`	Arabidopsis thaliana	Eukaryotic translation initiation factor 3 subunit A	69.729%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card