LXL04_032145 | RubberDandelionOmics

Gene overview

LXL04_032145

Reference: OH-1004 Chr: Chr07 Coordinates: 17432555-17432920 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · LXL04_032145|LXL04_032145|OH1004|cDNA

ATGCCTGTGTTTCCATCCAAGAGAGATGGAGTTAGTGGTCAGGTTCAAGATCTAGACACTGCCGTCAAAGATGGCGTTCtcggtggcggtggcggtggcggaGTGGGATTCGGCGGCGGATTTGCCGAGAAATTAGATCTGAACAAGATGATTGAAGAATTGGATCTGCCGGAGGTTCCATCTGTCTTCATTTGCCCAATTTCACTCGAACCGATGGAAGACCCGGTCACTCTTTGCACCGGCCAAACCTACGAACGCTC...

CDS

Download CDS FASTA

366 bp · LXL04_032145|LXL04_032145|OH1004|CDS

ATGCCTGTGTTTCCATCCAAGAGAGATGGAGTTAGTGGTCAGGTTCAAGATCTAGACACTGCCGTCAAAGATGGCGTTCTCGGTGGCGGTGGCGGTGGCGGAGTGGGATTCGGCGGCGGATTTGCCGAGAAATTAGATCTGAACAAGATGATTGAAGAATTGGATCTGCCGGAGGTTCCATCTGTCTTCATTTGCCCAATTTCACTCGAACCGATGGAAGACCCGGTCACTCTTTGCACCGGCCAAACCTACGAACGCTC...

Protein

Download Protein FASTA

121 aa · LXL04_032145|LXL04_032145|OH1004|PROTEIN

MPVFPSKRDGVSGQVQDLDTAVKDGVLGGGGGGGVGFGGGFAEKLDLNKMIEELDLPEVPSVFICPISLEPMEDPVTLCTGQTYERSNILRWFSMGHFTCPTTMQELWDDSVTPNKTHPTF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032145`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032145

Location Chr07:17432555-17432920 (-)

Description Similar to PUB31: U-box domain-containing protein 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65920`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At3g49810`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g29340`	Functions as an E3 ubiquitin ligase.	The E3 ubiquitin ligase activity of arabidopsis PLANT U-BOX17 and its functional tobacco homolog ACRE276 are required for cell death and defense.2006 · DOI: 10.1105/tpc.105.039198

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0232600`	E3 ubiquitin ligase that may function as positive regulator of brassinosteroid (BR) signaling.	The U-box E3 ubiquitin ligase TUD1 functions with a heterotrimeric G α subunit to regulate Brassinosteroid-mediated growth in rice.2013 · DOI: 10.1371/journal.pgen.1003391 An E3 ubiquitin ligase, ERECT LEAF1, functions in brassinosteroid signaling of rice.2013 · DOI: 10.4161/psb.27117
`Os06g0102700`	Possesses E3 ubiquitin-protein ligase in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032145 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0098542 defense response to other organism Biological Process

GO:1900457 regulation of brassinosteroid mediated signaling pathway Biological Process

GO:1901001 negative regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G29340

ath:AT3G49810

ath:AT5G65920

dosa:Os03g0232600

dosa:Os06g0102700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.525

Rank 1 · LXL04_032145 · OH-1004

Nucleus0.484

Rank 2 · LXL04_032145 · OH-1004

Cell membrane0.089

Rank 3 · LXL04_032145 · OH-1004

Endoplasmic reticulum0.069

Rank 4 · LXL04_032145 · OH-1004

Mitochondrion0.050

Rank 5 · LXL04_032145 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04564.22U-box59-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032145	`PF04564.22`	U-box	59	117	7e-13	49.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHN9`	Arabidopsis thaliana	U-box domain-containing protein 31	71.186%	Swiss-Prot	strong database homology
`Q058P4`	Arabidopsis thaliana	U-box domain-containing protein 30	72.800%	Swiss-Prot	strong database homology
`Q9C7R6`	Arabidopsis thaliana	U-box domain-containing protein 17	55.172%	Swiss-Prot	weak database homology
`Q10PI9`	Oryza sativa subsp. japonica	U-box domain-containing protein 75	60.177%	Swiss-Prot	strong database homology
`Q5VRH9`	Oryza sativa subsp. japonica	U-box domain-containing protein 12	57.627%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card