LXL04_032120 | RubberDandelionOmics

Gene overview

LXL04_032120

Reference: OH-1004 Chr: Chr07 Coordinates: 17068497-17073943 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1992 bp · LXL04_032120|LXL04_032120|OH1004|cDNA

ATGGGTTTAGACACGAACCGAGTGGAGGACAATTCGGGTTCGGGTCATGCTCAACCAGAAACCACCACGGTTTCTATAGTAGTTCCGCCGGAAACAATGGAGCCACGGGAACTACACGGCGTCTGTCTCCCGCCGAAGAAAACTAGTTTTCAGAAACTCCGGCACAAACTGTCGGAGATTTTCTTCCCTGACGATCCTCTCCACAGATTTAAAAACCAAACACGCTTTAACAAATTCCTCTTCGCTCTTCATTACGTCTT...

CDS

Download CDS FASTA

1992 bp · LXL04_032120|LXL04_032120|OH1004|CDS

ATGGGTTTAGACACGAACCGAGTGGAGGACAATTCGGGTTCGGGTCATGCTCAACCAGAAACCACCACGGTTTCTATAGTAGTTCCGCCGGAAACAATGGAGCCACGGGAACTACACGGCGTCTGTCTCCCGCCGAAGAAAACTAGTTTTCAGAAACTCCGGCACAAACTGTCGGAGATTTTCTTCCCTGACGATCCTCTCCACAGATTTAAAAACCAAACACGCTTTAACAAATTCCTCTTCGCTCTTCATTACGTCTT...

Protein

Download Protein FASTA

663 aa · LXL04_032120|LXL04_032120|OH1004|PROTEIN

MGLDTNRVEDNSGSGHAQPETTTVSIVVPPETMEPRELHGVCLPPKKTSFQKLRHKLSEIFFPDDPLHRFKNQTRFNKFLFALHYVFPIFQWAPTYNLTLFHSDVVAGLTIASLAIPQGISYAKLANLPPVIGLYSSFVPPLIYAVLGSSKHLAVGPVSIASLVMGTMLNDAVSYSLNPVLYLKLAFTATFFAGLFQASLGFLRLGFLIDFLSKATLVGFMAGAAVIVSMQQLKGLLGIVNFTTKMQIIPVLSSVIEQRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032120`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032120

Location Chr07:17068497-17073943 (+)

Description Similar to SULTR3;4: Probable sulfate transporter 3.4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15990`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At1g23090`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release
`At3g51895`	H(+)/sulfate cotransporter that may play a role in the regulation of sulfate assimilation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032120 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006817 phosphate ion transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008271 secondary active sulfate transmembrane transporter activity Molecular Function

GO:0015116 sulfate transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G23090

ath:AT3G15990

ath:AT3G51895

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.674

Rank 1 · LXL04_032120 · OH-1004

Cytoplasm0.139

Rank 2 · LXL04_032120 · OH-1004

Lysosome / Vacuole0.116

Rank 3 · LXL04_032120 · OH-1004

Endoplasmic reticulum0.075

Rank 4 · LXL04_032120 · OH-1004

Mitochondrion0.056

Rank 5 · LXL04_032120 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00916.27Sulfate_transp101-480 aa

PF01740.27STAS534-651 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032120	`PF00916.27`	Sulfate_transp	101	480	2.7e-127	425.4
LXL04_032120	`PF01740.27`	STAS	534	651	8.8e-24	84.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW86`	Arabidopsis thaliana	Probable sulfate transporter 3.4	69.335%	Swiss-Prot	strong database homology
`Q9SXS2`	Arabidopsis thaliana	Probable sulfate transporter 3.3	62.319%	Swiss-Prot	strong database homology
`Q9SV13`	Arabidopsis thaliana	Sulfate transporter 3.1	54.487%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card