LXL04_031982 | RubberDandelionOmics

Gene overview

LXL04_031982

Reference: OH-1004 Chr: Chr07 Coordinates: 14354472-14364411 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6723 bp · LXL04_031982|LXL04_031982|OH1004|cDNA

ATGGATACAGATGATGTAATAACTGGATTGCCGGAGAATAAAACCCGCCATAACCATATCCACTTAGACACCGTATCTGCAGGCGTCGACAGGAAAGCTTTCAGCGTTCTGTTGCACAAAAGAGGTAACAGTGCCAGGGTTCATATCCTGGATGACTCTCCGGGGAGTTACAGCGGCAGTGTAAAGTCCGAAACCGATCAAGGCTTCGACGACGAAATCAATTTGGACGTCGGCGATTCCCTGGTGAAGACAGACGGCGA...

CDS

Download CDS FASTA

6723 bp · LXL04_031982|LXL04_031982|OH1004|CDS

ATGGATACAGATGATGTAATAACTGGATTGCCGGAGAATAAAACCCGCCATAACCATATCCACTTAGACACCGTATCTGCAGGCGTCGACAGGAAAGCTTTCAGCGTTCTGTTGCACAAAAGAGGTAACAGTGCCAGGGTTCATATCCTGGATGACTCTCCGGGGAGTTACAGCGGCAGTGTAAAGTCCGAAACCGATCAAGGCTTCGACGACGAAATCAATTTGGACGTCGGCGATTCCCTGGTGAAGACAGACGGCGA...

Protein

Download Protein FASTA

2240 aa · LXL04_031982|LXL04_031982|OH1004|PROTEIN

MDTDDVITGLPENKTRHNHIHLDTVSAGVDRKAFSVLLHKRGNSARVHILDDSPGSYSGSVKSETDQGFDDEINLDVGDSLVKTDGEADVEDPELGVLAEGLDKRSLRIRQLSDELKRLTTFSKRQTTGRLDRTKTVAAYALKGLKFISKKEEGTTEIALEMRFEDLTKDTNGLLPRSLLWKCIGMNKESKEFAEELFVAVVQRRGWNIGDSINKVQMKEFWDEISDQSFDSRLRIFLDMVDKDADGRITEDEVRKIILI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031982`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031982

Location Chr07:14354472-14364411 (+)

Description Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47910`	Calcium-dependent NADPH oxidase that generates superoxide.	Arabidopsis gp91phox homologues AtrbohD and AtrbohF are required for accumulation of reactive oxygen intermediates in the plant defense response.2002 · DOI: 10.1073/pnas.012452499 NADPH oxidase AtrbohD and AtrbohF genes function in ROS-dependent ABA signaling in Arabidopsis.2003 · DOI: 10.1093/emboj/cdg277 Cytosolic ascorbate peroxidase 1 is a central component of the reactive oxygen gene network of Arabidopsis.2005 · DOI: 10.1105/tpc.104.026971 Extracellular ATP induces the accumulation of superoxide via NADPH oxidases in Arabidopsis.2006 · DOI: 10.1104/pp.105.073072 The role of NADPH oxidase and MAP kinase phosphatase in UV-B-dependent gene expression in Arabidopsis.2006 · DOI: 10.1111/j.1365-3040.2006.01555.x Arabidopsis thaliana expresses multiple lines of defense to counterattack Erwinia chrysanthemi.2007 · DOI: 10.1094/mpmi-20-7-0794 The MAP4 Kinase SIK1 Ensures Robust Extracellular ROS Burst and Antibacterial Immunity in Plants.2018 · DOI: 10.1016/j.chom.2018.08.007
`At5g51060`	Calcium-dependent NADPH oxidase that generates superoxide.	Reactive oxygen species produced by NADPH oxidase regulate plant cell growth.2003 · DOI: 10.1038/nature01485 Hydrogen peroxide mediates plant root cell response to nutrient deprivation.2004 · DOI: 10.1073/pnas.0401707101

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031982 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0004601 peroxidase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016174 NAD(P)H oxidase H2O2-forming activity Molecular Function

KEGG gene cross-reference

sot:102586476

sot:102598898

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.294

Rank 1 · LXL04_031982 · OH-1004

Endoplasmic reticulum0.279

Rank 2 · LXL04_031982 · OH-1004

Nucleus0.160

Rank 3 · LXL04_031982 · OH-1004

Cell membrane0.131

Rank 4 · LXL04_031982 · OH-1004

Mitochondrion0.107

Rank 5 · LXL04_031982 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08414.17NADPH_Ox130-232 aa

PF14223.15Retrotran_gag_2402-566 aa

PF22936.2Pol_BBD675-755 aa

PF13976.12gag_pre-integrs782-846 aa

PF00665.33rve865-960 aa

PF29688.1TnsB_C921-978 aa

PF25597.2SH3_retrovirus1034-1096 aa

PF07727.20RVT_21211-1456 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031982	`PF08414.17`	NADPH_Ox	130	232	1.8e-28	99.5
LXL04_031982	`PF14223.15`	Retrotran_gag_2	402	566	1.7e-31	110.0
LXL04_031982	`PF22936.2`	Pol_BBD	675	755	6.1e-22	78.4
LXL04_031982	`PF13976.12`	gag_pre-integrs	782	846	4.1e-14	52.8
LXL04_031982	`PF00665.33`	rve	865	960	5.8e-11	43.3
LXL04_031982	`PF29688.1`	TnsB_C	921	978	4.4e-06	27.3
LXL04_031982	`PF25597.2`	SH3_retrovirus	1034	1096	3.8e-25	88.2
LXL04_031982	`PF07727.20`	RVT_2	1211	1456	1.7e-78	264.3
LXL04_031982	`PF08022.19`	FAD_binding_8	1936	2054	6.9e-33	113.7
LXL04_031982	`PF08030.18`	NAD_binding_6	2060	2221	2e-36	126.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIJ0`	Arabidopsis thaliana	Respiratory burst oxidase homolog protein D	60.229%	Swiss-Prot	weak database homology
`O81210`	Arabidopsis thaliana	Respiratory burst oxidase homolog protein C	60.152%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card