LXL04_031971 | RubberDandelionOmics

Gene overview

LXL04_031971

Reference: OH-1004 Chr: Chr07 Coordinates: 14041646-14047243 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2256 bp · LXL04_031971|LXL04_031971|OH1004|cDNA

ATGGCAAAGGAGAGATTGGCAAGATCTGTGTTTGGAGACGCTTATTGTGGTGAAATGACATCTTCGGAGGCTTCAAGCAAAGGTAATAACATGAGAGGAGACAGAGACACGTTTTCTTTGTCTGGTTTTAGCGACAAAAATGATGCGGTAGGTGATTCAAGAGCTGTTCCAGCGGTTTCCGGTGCCGGAAAAGTTGATGCGGATATGGCTCTTTACAAGGAGCTCTGGCGAGCATGTGCTGGTCCGCTCGTTACTGTACC...

CDS

Download CDS FASTA

2256 bp · LXL04_031971|LXL04_031971|OH1004|CDS

ATGGCAAAGGAGAGATTGGCAAGATCTGTGTTTGGAGACGCTTATTGTGGTGAAATGACATCTTCGGAGGCTTCAAGCAAAGGTAATAACATGAGAGGAGACAGAGACACGTTTTCTTTGTCTGGTTTTAGCGACAAAAATGATGCGGTAGGTGATTCAAGAGCTGTTCCAGCGGTTTCCGGTGCCGGAAAAGTTGATGCGGATATGGCTCTTTACAAGGAGCTCTGGCGAGCATGTGCTGGTCCGCTCGTTACTGTACC...

Protein

Download Protein FASTA

751 aa · LXL04_031971|LXL04_031971|OH1004|PROTEIN

MAKERLARSVFGDAYCGEMTSSEASSKGNNMRGDRDTFSLSGFSDKNDAVGDSRAVPAVSGAGKVDADMALYKELWRACAGPLVTVPRENELVFYFPQGHIEQVEASTNQVAEQQMPMYNLPSKILCRVVNVQLKAEQETDEVFAQITLMPEADQDETTVKKEPPPPPQSRFQVHSFCKTLTASDTSTHGGFSVLRRHADECLPQLDMSRQPPTQELVAKDLHSTEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031971`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031971

Location Chr07:14041646-14047243 (-)

Description Similar to ARF2B: Auxin response factor 2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62000`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	AUXIN RESPONSE FACTOR 2 (ARF2): a pleiotropic developmental regulator.2005 · DOI: 10.1111/j.1365-313x.2005.02426.x AUXIN RESPONSE FACTOR1 and AUXIN RESPONSE FACTOR2 regulate senescence and floral organ abscission in Arabidopsis thaliana.2005 · DOI: 10.1242/dev.02012 The AUXIN RESPONSE FACTOR 2 gene of Arabidopsis links auxin signalling, cell division, and the size of seeds and other organs.2006 · DOI: 10.1242/dev.02194
`At1g59750`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0927600`	Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031971 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008219 cell death Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009835 fruit ripening Biological Process

GO:0009836 fruit ripening, climacteric Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010047 fruit dehiscence Biological Process

GO:0010150 leaf senescence Biological Process

KEGG gene cross-reference

ath:AT1G59750

ath:AT5G62000

dosa:Os01g0927600

sly:778240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · LXL04_031971 · OH-1004

Cytoplasm0.079

Rank 2 · LXL04_031971 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_031971 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_031971 · OH-1004

Plastid0.014

Rank 5 · LXL04_031971 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362.27B3177-278 aa

PF25313.2BRWD_AD307-408 aa

PF06507.20ARF_AD326-408 aa

PF02309.23AUX_IAA597-663 aa

PF02309.23AUX_IAA672-709 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031971	`PF02362.27`	B3	177	278	1.9e-22	79.8
LXL04_031971	`PF25313.2`	BRWD_AD	307	408	6.1e-12	46.6
LXL04_031971	`PF06507.20`	ARF_AD	326	408	2.5e-36	124.1
LXL04_031971	`PF02309.23`	AUX_IAA	597	663	1.5e-13	51.7
LXL04_031971	`PF02309.23`	AUX_IAA	672	709	1.5e-13	51.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JM3`	Arabidopsis thaliana	Auxin response factor 2	57.043%	Swiss-Prot	strong database homology
`Q8L7G0`	Arabidopsis thaliana	Auxin response factor 1	53.881%	Swiss-Prot	strong database homology
`Q5JK20`	Oryza sativa subsp. japonica	Auxin response factor 4	72.381%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card