LXL04_031089 | RubberDandelionOmics

Gene overview

LXL04_031089

Reference: OH-1004 Chr: Chr07 Coordinates: 304147-306557 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1206 bp · LXL04_031089|LXL04_031089|OH1004|cDNA

ATGTGTAACCCAACACCATCTTCCTCATCCAAACTTGTCATTTCCAAGAATACCCTTTTCAAGAATCTCACCAACAAGCCCCCAAAATCTATGGAAGAACCTCATCACCAACTTGAGGGATGGCCAACCCCTTCTCAGGCCTTAGAGGAAATAAAAGCTATTGGAAAGATCTCAGGACCAATTGCCATGACTGGTTTACTACTATACTCGAGAGCCATGATCTCCATGCTTTTCCTGGGCTATCTCGGGGAGCTTGAGTT...

CDS

Download CDS FASTA

1206 bp · LXL04_031089|LXL04_031089|OH1004|CDS

ATGTGTAACCCAACACCATCTTCCTCATCCAAACTTGTCATTTCCAAGAATACCCTTTTCAAGAATCTCACCAACAAGCCCCCAAAATCTATGGAAGAACCTCATCACCAACTTGAGGGATGGCCAACCCCTTCTCAGGCCTTAGAGGAAATAAAAGCTATTGGAAAGATCTCAGGACCAATTGCCATGACTGGTTTACTACTATACTCGAGAGCCATGATCTCCATGCTTTTCCTGGGCTATCTCGGGGAGCTTGAGTT...

Protein

Download Protein FASTA

401 aa · LXL04_031089|LXL04_031089|OH1004|PROTEIN

MCNPTPSSSSKLVISKNTLFKNLTNKPPKSMEEPHHQLEGWPTPSQALEEIKAIGKISGPIAMTGLLLYSRAMISMLFLGYLGELELAGGSLSIGFANITGYSIISGLAMGMEPICGQAYGAKQMKLLGLTLQRTVLLLLSASLPISFMWLNMKTILLWCGQDEEISETARTFIVFTIPDLFVLSLLHPLRVYLRTQNITLPLTCCSAVSVLLHVPLNYLLVGYLKMGVSGVAVAVVITNLNLLFLLTTVVYFSGVHWDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031089`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031089

Location Chr07:304147-306557 (+)

Description Similar to DTX48: Protein DETOXIFICATION 48

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g58340`	Functions as a multidrug and toxin extrusion transporter.	A Golgi-localized MATE transporter mediates iron homoeostasis under osmotic stress in Arabidopsis.2012 · DOI: 10.1042/bj20111311 A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344
`At4g29140`	Functions as a multidrug and toxin extrusion transporter that negatively regulates plant disease resistance.	ADP1 affects plant architecture by regulating local auxin biosynthesis.2014 · DOI: 10.1371/journal.pgen.1003954 A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344
`At4g23030`	Protein DETOXIFICATION 49.	No verified direct reference in this release
`At5g19700`	May act as a negative regulator of hypocotyl cell elongation in the light.	A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344
`At5g52050`	Functions as a multidrug and toxin extrusion transporter in the export of abscisic acid (ABA) in guard cells.	A DTX/MATE-type transporter facilitates abscisic acid efflux and modulates ABA sensitivity and drought tolerance in Arabidopsis.2014 · DOI: 10.1093/mp/ssu063 A subgroup of MATE transporter genes regulates hypocotyl cell elongation in Arabidopsis.2015 · DOI: 10.1093/jxb/erv344

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031089 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006826 iron ion transport Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009624 response to nematode Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010600 regulation of auxin biosynthetic process Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0046620 regulation of organ growth Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

KEGG gene cross-reference

ath:AT1G58340

ath:AT4G23030

ath:AT4G29140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.383

Rank 1 · LXL04_031089 · OH-1004

Cell membrane0.303

Rank 2 · LXL04_031089 · OH-1004

Endoplasmic reticulum0.133

Rank 3 · LXL04_031089 · OH-1004

Golgi apparatus0.096

Rank 4 · LXL04_031089 · OH-1004

Cytoplasm0.088

Rank 5 · LXL04_031089 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554.24MatE60-220 aa

PF01554.24MatE283-349 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031089	`PF01554.24`	MatE	60	220	4.4e-46	157.2
LXL04_031089	`PF01554.24`	MatE	283	349	4.4e-46	157.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLV0`	Arabidopsis thaliana	Protein DETOXIFICATION 48	70.890%	Swiss-Prot	strong database homology
`Q9SZE2`	Arabidopsis thaliana	Protein DETOXIFICATION 51	45.833%	Swiss-Prot	moderate database homology
`O82752`	Arabidopsis thaliana	Protein DETOXIFICATION 49	57.647%	Swiss-Prot	moderate database homology
`Q4PSF4`	Arabidopsis thaliana	Protein DETOXIFICATION 52	46.332%	Swiss-Prot	moderate database homology
`Q9FJ87`	Arabidopsis thaliana	Protein DETOXIFICATION 50	43.798%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card