LXL04_031067 | RubberDandelionOmics

Gene overview

LXL04_031067

Reference: OH-1004 Chr: Chr06 Coordinates: 127408081-127411337 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2271 bp · LXL04_031067|LXL04_031067|OH1004|cDNA

ATGACGGTCGGAGCAGGTATATCGGTGACAGATCGGAAGCTCAATGTGCTGGGGGTTCCCGTGTTGACGGACGTACATGACAATGTATTCGTCACTTCATCAACCGGCGACGAGATGATGAATGGCGCGTTCATCGGCGTGCAATCGGGTCAGACTGGCAGTCGCATGGTCTTTCCTATCGGAAAACTCGAGGGATTGAGATTCATGTCTGTGTTCCGCTTCAAGTTATGGTGGATGACACAGAGAATGGGAACATGCGG...

CDS

Download CDS FASTA

2271 bp · LXL04_031067|LXL04_031067|OH1004|CDS

ATGACGGTCGGAGCAGGTATATCGGTGACAGATCGGAAGCTCAATGTGCTGGGGGTTCCCGTGTTGACGGACGTACATGACAATGTATTCGTCACTTCATCAACCGGCGACGAGATGATGAATGGCGCGTTCATCGGCGTGCAATCGGGTCAGACTGGCAGTCGCATGGTCTTTCCTATCGGAAAACTCGAGGGATTGAGATTCATGTCTGTGTTCCGCTTCAAGTTATGGTGGATGACACAGAGAATGGGAACATGCGG...

Protein

Download Protein FASTA

756 aa · LXL04_031067|LXL04_031067|OH1004|PROTEIN

MTVGAGISVTDRKLNVLGVPVLTDVHDNVFVTSSTGDEMMNGAFIGVQSGQTGSRMVFPIGKLEGLRFMSVFRFKLWWMTQRMGTCGQDIPTETQFLIIETNDGSHFGEDDEVADGCHQSALYTVFLPIIEGDFRAVIQGNGNNELEICLESGDPAVKEFEGSHLVFVAAGLDPFDVITNAVKSVERHLQTFCHRERKKMPGMLNWFGWCTWDAFYTDVTCEGVKQGLESFEKGGISPKFVIIDDGWQSVGMDPTSVEAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031067`
TK1151 ID	TkA01G616100
OH-1004 ID	LXL04_031067
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	56.400
Protein coverage (%)	TK1151 99.737 / OH-1004 99.735 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031067

Location Chr06:127408081-127411337 (+)

Description Similar to RFS1: Probable galactinol--sucrose galactosyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55740`	Transglycosidase operating by a ping-pong reaction mechanism.	No verified direct reference in this release
`At3g57520`	Transglycosidase operating by a ping-pong reaction mechanism.	No verified direct reference in this release
`At5g20250`	Transglycosidase operating by a ping-pong reaction mechanism.	No verified direct reference in this release
`At5g40390`	Transglycosidase operating by a ping-pong reaction mechanism.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0170000`	Transglycosidase operating by a ping-pong reaction mechanism.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031067 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0034484 raffinose catabolic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0016757 glycosyltransferase activity Molecular Function

GO:0047274 galactinol-sucrose galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G55740

ath:AT3G57520

ath:AT5G20250

ath:AT5G40390

dosa:Os01g0170000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · LXL04_031067 · OH-1004

Nucleus0.190

Rank 2 · LXL04_031067 · OH-1004

Cell membrane0.112

Rank 3 · LXL04_031067 · OH-1004

Endoplasmic reticulum0.109

Rank 4 · LXL04_031067 · OH-1004

Mitochondrion0.085

Rank 5 · LXL04_031067 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05691.19Raffinose_syn9-739 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031067	`PF05691.19`	Raffinose_syn	9	739		1015.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84VX0`	Arabidopsis thaliana	Probable galactinol--sucrose galactosyltransferase 1	72.047%	Swiss-Prot	strong database homology
`Q94A08`	Arabidopsis thaliana	Probable galactinol--sucrose galactosyltransferase 2	56.815%	Swiss-Prot	strong database homology
`Q8RX87`	Arabidopsis thaliana	Probable galactinol--sucrose galactosyltransferase 6	55.526%	Swiss-Prot	strong database homology
`Q9FND9`	Arabidopsis thaliana	Probable galactinol--sucrose galactosyltransferase 5	39.553%	Swiss-Prot	moderate database homology
`Q5VQG4`	Oryza sativa subsp. japonica	Galactinol--sucrose galactosyltransferase	38.521%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card