LXL04_031065 | RubberDandelionOmics

Gene overview

LXL04_031065

Reference: OH-1004 Chr: Chr06 Coordinates: 127400601-127401627 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

942 bp · LXL04_031065|LXL04_031065|OH1004|cDNA

ATGGGTAGAATCCCATGTTGCGAAAAGGAGAGTGTGAAGAAGGGTCAGTGGACCCCTGAAGAAGACCACAAGCTGTCTTCCTATATCGCTCAACATGGGACTCGTAATTGGCGACTCATTCCCAAAAATGCAGGCCTCCAAAGATGTGGGAAGAGCTGCAGGCTGCGCTGGACTAACTACCTCCGCCCTGATCTTAAACACGGACAGTTCTCCGACACCGAAGAACAAATTATTGTCCGCCTACATTCCGTTCTAGGCAA...

CDS

Download CDS FASTA

942 bp · LXL04_031065|LXL04_031065|OH1004|CDS

ATGGGTAGAATCCCATGTTGCGAAAAGGAGAGTGTGAAGAAGGGTCAGTGGACCCCTGAAGAAGACCACAAGCTGTCTTCCTATATCGCTCAACATGGGACTCGTAATTGGCGACTCATTCCCAAAAATGCAGGCCTCCAAAGATGTGGGAAGAGCTGCAGGCTGCGCTGGACTAACTACCTCCGCCCTGATCTTAAACACGGACAGTTCTCCGACACCGAAGAACAAATTATTGTCCGCCTACATTCCGTTCTAGGCAA...

Protein

Download Protein FASTA

313 aa · LXL04_031065|LXL04_031065|OH1004|PROTEIN

MGRIPCCEKESVKKGQWTPEEDHKLSSYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYLRPDLKHGQFSDTEEQIIVRLHSVLGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPVTHKPYSHLMAEIATTLAPPQVANLAEATLGCLKDEMLHLLTKKHIDIQFQSPNSHAPPQTSPNSYNITSKHESNDDDDDDDTIEKIKLGLSRAIIHEPHTTNKPCWDANMNGASSANFPGFHYALPSFGHESPWSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031065`
TK1151 ID	TkA04G033080
OH-1004 ID	LXL04_031065
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.400
Protein coverage (%)	TK1151 98.400 / OH-1004 44.728 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031065

Location Chr06:127400601-127401627 (+)

Description Similar to MYB80: Transcription factor MYB80

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56110`	Transcription factor that binds to the DNA sequence 5'- CCAACC-3'.	AtMYB103 regulates tapetum and trichome development in Arabidopsis thaliana.2003 · DOI: 10.1046/j.1365-313x.2003.01791.x Transcription factor AtMYB103 is required for anther development by regulating tapetum development, callose dissolution and exine formation in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03254.x The MYB80 transcription factor is required for pollen development and the regulation of tapetal programmed cell death in Arabidopsis thaliana.2011 · DOI: 10.1105/tpc.110.082651
`At4g21440`	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable).	Integration of wounding and osmotic stress signals determines the expression of the AtMYB102 transcription factor gene.2003 · DOI: 10.1104/pp.102.019273 The Arabidopsis thaliana Transcription Factor AtMYB102 Functions in Defense Against the Insect Herbivore Pieris rapae.2006 · DOI: 10.4161/psb.1.6.3512
`At4g05100`	Probable transcription factor that may function in salt stress response.	Salt-induced transcription factor MYB74 is regulated by the RNA-directed DNA methylation pathway in Arabidopsis.2015 · DOI: 10.1093/jxb/erv312
`At4g28110`	Transcription factor involved in salt stress response.	AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis.2009 · DOI: 10.1104/pp.108.134874 Phosphorylation by AtMPK6 is required for the biological function of AtMYB41 in Arabidopsis.2012 · DOI: 10.1016/j.bbrc.2012.04.137 AtMYB41 activates ectopic suberin synthesis and assembly in multiple plant species and cell types.2014 · DOI: 10.1111/tpj.12624

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0470600`	Essential for tapetum development in anthers and microsporogenesis.	MYB80, a regulator of tapetal and pollen development, is functionally conserved in crops.2012 · DOI: 10.1007/s11103-011-9855-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031065 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048658 anther wall tapetum development Biological Process

KEGG gene cross-reference

ath:AT4G05100

ath:AT4G21440

ath:AT4G28110

ath:AT5G56110

osa:9272494

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.850

Rank 1 · LXL04_031065 · OH-1004

Cytoplasm0.267

Rank 2 · LXL04_031065 · OH-1004

Mitochondrion0.035

Rank 3 · LXL04_031065 · OH-1004

Cell membrane0.022

Rank 4 · LXL04_031065 · OH-1004

Endoplasmic reticulum0.013

Rank 5 · LXL04_031065 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding14-61 aa

PF13921.13Myb_DNA-bind_617-76 aa

PF00249.38Myb_DNA-binding68-110 aa

PF13921.13Myb_DNA-bind_670-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031065	`PF00249.38`	Myb_DNA-binding	14	61	1.3e-34	118.8
LXL04_031065	`PF13921.13`	Myb_DNA-bind_6	17	76	1.7e-21	76.9
LXL04_031065	`PF00249.38`	Myb_DNA-binding	68	110	1.3e-34	118.8
LXL04_031065	`PF13921.13`	Myb_DNA-bind_6	70	117	1.7e-21	76.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XHV0`	Arabidopsis thaliana	Transcription factor MYB80	87.719%	Swiss-Prot	moderate database homology
`Q9LDR8`	Arabidopsis thaliana	Transcription factor MYB102	66.667%	Swiss-Prot	weak database homology
`Q9M0Y5`	Arabidopsis thaliana	Transcription factor MYB74	69.767%	Swiss-Prot	weak database homology
`Q9M0J5`	Arabidopsis thaliana	Transcription factor MYB41	69.531%	Swiss-Prot	weak database homology
`Q7XQN1`	Oryza sativa subsp. japonica	Transcription factor MYB80	52.406%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card