LXL04_031049 | RubberDandelionOmics

Gene overview

LXL04_031049

Reference: OH-1004 Chr: Chr06 Coordinates: 127229302-127232053 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2229 bp · LXL04_031049|LXL04_031049|OH1004|cDNA

ATGACGACATTTTTAGATCTATACAAGGAAGGCAAAATGGATGTTGTAAATGGTCCATTATTTGAAACAGAGGGAGGAAAAGGGAGGAAGATATACAGGGCGTTTGCGGCGACGGTGTTGGTAAGCGTTGCATGGATATGGGTTTACAGAGCAACGCAACTACTGCCACCTGCTTCCGGGAGCCGGTTTATGATCGGAATGTTTGCCGCCGAGCTATGGTTCGGTCTGTACTGGATGTTGACTCAATCGGTCCGGTGGAA...

CDS

Download CDS FASTA

2229 bp · LXL04_031049|LXL04_031049|OH1004|CDS

ATGACGACATTTTTAGATCTATACAAGGAAGGCAAAATGGATGTTGTAAATGGTCCATTATTTGAAACAGAGGGAGGAAAAGGGAGGAAGATATACAGGGCGTTTGCGGCGACGGTGTTGGTAAGCGTTGCATGGATATGGGTTTACAGAGCAACGCAACTACTGCCACCTGCTTCCGGGAGCCGGTTTATGATCGGAATGTTTGCCGCCGAGCTATGGTTCGGTCTGTACTGGATGTTGACTCAATCGGTCCGGTGGAA...

Protein

Download Protein FASTA

742 aa · LXL04_031049|LXL04_031049|OH1004|PROTEIN

MTTFLDLYKEGKMDVVNGPLFETEGGKGRKIYRAFAATVLVSVAWIWVYRATQLLPPASGSRFMIGMFAAELWFGLYWMLTQSVRWNPTHRRTFKQRLTQRSIRTLKFENELPGVDVFVCTADPVIEPPMMVISTVLSVMAYDYPPEKLSVYLSDDGGSELTFYALTQAAIFSEHWLPYCRNYKIEPRSPIAYFQSESIPSHTKHHQDFVAVQRLFEDMTNRVENVTKMGSVPEELRRQQKGFKEWDSFTSPRDHAAIVH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031049`
TK1151 ID	TkA04G396200
OH-1004 ID	LXL04_031049
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.400
Protein coverage (%)	TK1151 84.800 / OH-1004 14.016 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031049

Location Chr06:127229302-127232053 (-)

Description Similar to CSLE1: Cellulose synthase-like protein E1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55850`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`At4g23990`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q651X6`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`Os09g0478100`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`Os02g0725300`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031049 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016759 cellulose synthase activity Molecular Function

GO:0016760 cellulose synthase (UDP-forming) activity Molecular Function

KEGG gene cross-reference

ath:AT1G55850

ath:AT4G23990

dosa:Os02g0725300

dosa:Os09g0478100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.356

Rank 1 · LXL04_031049 · OH-1004

Endoplasmic reticulum0.274

Rank 2 · LXL04_031049 · OH-1004

Golgi apparatus0.244

Rank 3 · LXL04_031049 · OH-1004

Cytoplasm0.135

Rank 4 · LXL04_031049 · OH-1004

Lysosome / Vacuole0.117

Rank 5 · LXL04_031049 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552.21Cellulose_synt115-403 aa

PF03552.21Cellulose_synt426-739 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031049	`PF03552.21`	Cellulose_synt	115	403	6.9e-136	455.4
LXL04_031049	`PF03552.21`	Cellulose_synt	426	739	6.9e-136	455.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZK9`	Arabidopsis thaliana	Cellulose synthase-like protein E1	52.322%	Swiss-Prot	strong database homology
`Q0WVN5`	Arabidopsis thaliana	Cellulose synthase-like protein G3	36.755%	Swiss-Prot	moderate database homology
`Q651X6`	Oryza sativa subsp. japonica	Cellulose synthase-like protein E6	50.754%	Swiss-Prot	strong database homology
`Q651X7`	Oryza sativa subsp. japonica	Cellulose synthase-like protein E1	49.178%	Swiss-Prot	moderate database homology
`Q0DXZ1`	Oryza sativa subsp. japonica	Cellulose synthase-like protein E2	50.681%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card