LXL04_031041 | RubberDandelionOmics

Gene overview

LXL04_031041

Reference: OH-1004 Chr: Chr06 Coordinates: 127167161-127168411 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1251 bp · LXL04_031041|LXL04_031041|OH1004|cDNA

ATGCAGCTCCGTTCCATGGCGGCGGTCACGGCAGTTGTCATCTCTATGCTAGGGTTGTTAATGTCTGGAGCAACCGTTGAAGGCCACAACATCACCAGCATTCTGGCTAAGTTTCCGGAGTTCTCGACTTTCAACCATTACCTCACAATTACACACCTCGCCGATGAAATTAATAACCGACAGACTATCACCGTCTGTGCTGTAGACAATGCCGGAATGTCAGATCTGCTAAGCAAACACTTATCTGTGTACGCTATGAA...

CDS

Download CDS FASTA

1251 bp · LXL04_031041|LXL04_031041|OH1004|CDS

ATGCAGCTCCGTTCCATGGCGGCGGTCACGGCAGTTGTCATCTCTATGCTAGGGTTGTTAATGTCTGGAGCAACCGTTGAAGGCCACAACATCACCAGCATTCTGGCTAAGTTTCCGGAGTTCTCGACTTTCAACCATTACCTCACAATTACACACCTCGCCGATGAAATTAATAACCGACAGACTATCACCGTCTGTGCTGTAGACAATGCCGGAATGTCAGATCTGCTAAGCAAACACTTATCTGTGTACGCTATGAA...

Protein

Download Protein FASTA

416 aa · LXL04_031041|LXL04_031041|OH1004|PROTEIN

MQLRSMAAVTAVVISMLGLLMSGATVEGHNITSILAKFPEFSTFNHYLTITHLADEINNRQTITVCAVDNAGMSDLLSKHLSVYAMKNVLSLHVLLDYFGAKKLHQITNGTALAATMFQATGTASGASGFVNITDLKGGKVGFGSEETGKTDATFVKSVHELPYNISVIQISSMLPSAEAEAPTPEPAAVNITSLMSAHGCMNFAEALLASAAMKTYEDNIDGGLSVFCPLDDAFKAFLPKYKNLTVGGKQSLLEYHGVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031041`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031041

Location Chr06:127167161-127168411 (+)

Description Similar to FLA2: Fasciclin-like arabinogalactan protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12730`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At5g55730`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g60900`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At2g45470`	May be a cell surface adhesion protein.	No verified direct reference in this release
`At3g46550`	May be a cell surface adhesion protein that is required for normal cell expansion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031041 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007155 cell adhesion Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010192 mucilage biosynthetic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G45470

ath:AT3G46550

ath:AT3G60900

ath:AT4G12730

ath:AT5G55730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.456

Rank 1 · LXL04_031041 · OH-1004

Extracellular0.344

Rank 2 · LXL04_031041 · OH-1004

Endoplasmic reticulum0.126

Rank 3 · LXL04_031041 · OH-1004

Cytoplasm0.098

Rank 4 · LXL04_031041 · OH-1004

Lysosome / Vacuole0.045

Rank 5 · LXL04_031041 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02469.28Fasciclin39-120 aa

PF02469.28Fasciclin201-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031041	`PF02469.28`	Fasciclin	39	120	3.3e-22	79.7
LXL04_031041	`PF02469.28`	Fasciclin	201	329	3.3e-22	79.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU13`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 2	53.678%	Swiss-Prot	strong database homology
`Q9FM65`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 1	61.326%	Swiss-Prot	strong database homology
`Q9LZX4`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 10	47.328%	Swiss-Prot	moderate database homology
`O22126`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 8	46.579%	Swiss-Prot	moderate database homology
`Q9SNC3`	Arabidopsis thaliana	Fasciclin-like arabinogalactan protein 4	31.233%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card