LXL04_030372 | RubberDandelionOmics

Gene overview

LXL04_030372

Reference: OH-1004 Chr: Chr06 Coordinates: 114971044-114972252 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · LXL04_030372|LXL04_030372|OH1004|cDNA

ATGCAGACAATTATCTTCATTTTCAAGATCATTATCTTCGTTTTTGTAGTCAGTACAAGTCATGGAGGAATAACTTCCATAATTGATGGAACCCCTCTCAAAGTAATCAAAGATGAACTCGATGGACTAGCCTTCATTGATCAAAGACTCTCAATCATCTACCCGTTGATACAAACCTTCAAGAACACCATCTCCTCCGACCCCCTTAACATCACCGGATCTTGGGTGGGGTCCGATATATGTAGTTACAGAGGCTTTTA...

CDS

Download CDS FASTA

1209 bp · LXL04_030372|LXL04_030372|OH1004|CDS

ATGCAGACAATTATCTTCATTTTCAAGATCATTATCTTCGTTTTTGTAGTCAGTACAAGTCATGGAGGAATAACTTCCATAATTGATGGAACCCCTCTCAAAGTAATCAAAGATGAACTCGATGGACTAGCCTTCATTGATCAAAGACTCTCAATCATCTACCCGTTGATACAAACCTTCAAGAACACCATCTCCTCCGACCCCCTTAACATCACCGGATCTTGGGTGGGGTCCGATATATGTAGTTACAGAGGCTTTTA...

Protein

Download Protein FASTA

402 aa · LXL04_030372|LXL04_030372|OH1004|PROTEIN

MQTIIFIFKIIIFVFVVSTSHGGITSIIDGTPLKVIKDELDGLAFIDQRLSIIYPLIQTFKNTISSDPLNITGSWVGSDICSYRGFYCDNPPDNKTATTIASIDFNGFQLTAPSLDGFLDQLPDLALFHANSNFFSGTISPNIANLPYLYELDISNNLFSGSFPNSILGMNSLSFLDIRFNLFTGSIPPQLFTKDLDILFVNNNNFIQKLADVLGNSHILYLTLANNRFYGPIPRTIAKYLSGLSEILLLNNMLSECLPY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030372`
TK1151 ID	TkA07G400160
OH-1004 ID	LXL04_030372
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030372

Location Chr06:114971044-114972252 (-)

Description Similar to At4g06744: Uncharacterized protein At4g06744

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g06744`	Uncharacterized protein At4g06744.	No verified direct reference in this release
`At3g24480`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At4g13340`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At4g18670`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At2g15880`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030372 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0005199 structural constituent of cell wall Molecular Function

GO:0042277 peptide binding Molecular Function

KEGG gene cross-reference

ath:AT2G15880

ath:AT3G24480

ath:AT4G06744

ath:AT4G13340

ath:AT4G18670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.442

Rank 1 · LXL04_030372 · OH-1004

Endoplasmic reticulum0.106

Rank 2 · LXL04_030372 · OH-1004

Lysosome / Vacuole0.103

Rank 3 · LXL04_030372 · OH-1004

Extracellular0.097

Rank 4 · LXL04_030372 · OH-1004

Cytoplasm0.078

Rank 5 · LXL04_030372 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W3M4`	Arabidopsis thaliana	Uncharacterized protein At4g06744	55.612%	Swiss-Prot	strong database homology
`Q9LHF1`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 4	43.210%	Swiss-Prot	moderate database homology
`Q9T0K5`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 3	41.916%	Swiss-Prot	moderate database homology
`Q9SN46`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 5	42.945%	Swiss-Prot	moderate database homology
`Q9XIL9`	Arabidopsis thaliana	Pollen-specific leucine-rich repeat extensin-like protein 3	39.233%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card