LXL04_030096 | RubberDandelionOmics

Gene overview

LXL04_030096

Reference: OH-1004 Chr: Chr06 Coordinates: 107857800-107859755 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · LXL04_030096|LXL04_030096|OH1004|cDNA

ATGACGAATCCAAATGCGGTGGTTTCCGACACCCAATCCGCCATTGGCATGGCTATCACAGTGGCCGTTAATAGCTCCTCTCTCTACTCCCAGTCGGTTCCCAATTCTCCTTACAACATCGCTTTGTTTTCAAGAAACAAGTTCCCAATGAGTATTGAAACCGCCGTCGCATCAGGCGGCGGAGGCCATGGGGGAGTGCCGAAGAACGTTGCATGGGTGGAAGCTATGAGAGCTTCTTCTCCGACTAGAAACTCTTCTGA...

CDS

Download CDS FASTA

1122 bp · LXL04_030096|LXL04_030096|OH1004|CDS

ATGACGAATCCAAATGCGGTGGTTTCCGACACCCAATCCGCCATTGGCATGGCTATCACAGTGGCCGTTAATAGCTCCTCTCTCTACTCCCAGTCGGTTCCCAATTCTCCTTACAACATCGCTTTGTTTTCAAGAAACAAGTTCCCAATGAGTATTGAAACCGCCGTCGCATCAGGCGGCGGAGGCCATGGGGGAGTGCCGAAGAACGTTGCATGGGTGGAAGCTATGAGAGCTTCTTCTCCGACTAGAAACTCTTCTGA...

Protein

Download Protein FASTA

373 aa · LXL04_030096|LXL04_030096|OH1004|PROTEIN

MTNPNAVVSDTQSAIGMAITVAVNSSSLYSQSVPNSPYNIALFSRNKFPMSIETAVASGGGGHGGVPKNVAWVEAMRASSPTRNSSEDSEDKKAWIMKHPSALGVFEEIMGAAKMKQVVIFLDYDGTLSPIVENPDQAYMAPEMREAVKNVAKYFPTAIVSGRCRAKVYNFVRLSELYYAGSHGMDIKGPSSGKHQKGNQNVLCQPAKEFLPMMAEVYKSLLEKTKDIVGANVENNKFCLSVHFRRVDEKNWSDLADRVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030096`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030096

Location Chr06:107857800-107859755 (+)

Description Similar to TPPD: Probable trehalose-phosphate phosphatase D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35910`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`At1g78090`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	Trehalose-6-phosphate phosphatases from Arabidopsis thaliana: identification by functional complementation of the yeast tps2 mutant.1998 · DOI: 10.1046/j.1365-313x.1998.00064.x
`At4g39770`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`At5g10100`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0753000`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030096 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005992 trehalose biosynthetic process Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004805 trehalose-phosphatase activity Molecular Function

GO:0015927 trehalase activity Molecular Function

KEGG gene cross-reference

ath:AT1G35910

ath:AT1G78090

ath:AT4G39770

ath:AT5G10100

dosa:Os02g0753000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.890

Rank 1 · LXL04_030096 · OH-1004

Mitochondrion0.090

Rank 2 · LXL04_030096 · OH-1004

Nucleus0.051

Rank 3 · LXL04_030096 · OH-1004

Cytoplasm0.041

Rank 4 · LXL04_030096 · OH-1004

Cell membrane0.028

Rank 5 · LXL04_030096 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02358.23Trehalose_PPase121-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030096	`PF02358.23`	Trehalose_PPase	121	353	1.4e-75	254.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67XC9`	Arabidopsis thaliana	Probable trehalose-phosphate phosphatase D	63.255%	Swiss-Prot	strong database homology
`Q9C9S4`	Arabidopsis thaliana	Trehalose-phosphate phosphatase B	60.800%	Swiss-Prot	strong database homology
`Q8GWG2`	Arabidopsis thaliana	Probable trehalose-phosphate phosphatase H	68.543%	Swiss-Prot	strong database homology
`F4KFG5`	Arabidopsis thaliana	Probable trehalose-phosphate phosphatase I	65.190%	Swiss-Prot	strong database homology
`Q6ZGP8`	Oryza sativa subsp. japonica	Probable trehalose-phosphate phosphatase 4	70.333%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card