LXL04_029363 | RubberDandelionOmics

Gene overview

LXL04_029363

Reference: OH-1004 Chr: Chr06 Coordinates: 88370869-88373170 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1236 bp · LXL04_029363|LXL04_029363|OH1004|cDNA

ATGTACCACGCCTTTAATCTATTCGGTTGGTGTACACTTTATGCATACCAGTGTATGATTGAAAAAGCAAGTCAATGGCTATGTGTAATTCTGGTGTGTTTACTTCAAGTACTGGAAACCTATGGTTTCTATGTTGATATTACTTATCTCGAAAGTGCAGTGGAAAAAGGAGCAGTTTGTTTGGATGGAAGCCCACCTGCATACCATTGGGACATGGGATATGATACAGGAATGGACAACTGGTTAGTACACATTGAGGG...

CDS

Download CDS FASTA

1236 bp · LXL04_029363|LXL04_029363|OH1004|CDS

ATGTACCACGCCTTTAATCTATTCGGTTGGTGTACACTTTATGCATACCAGTGTATGATTGAAAAAGCAAGTCAATGGCTATGTGTAATTCTGGTGTGTTTACTTCAAGTACTGGAAACCTATGGTTTCTATGTTGATATTACTTATCTCGAAAGTGCAGTGGAAAAAGGAGCAGTTTGTTTGGATGGAAGCCCACCTGCATACCATTGGGACATGGGATATGATACAGGAATGGACAACTGGTTAGTACACATTGAGGG...

Protein

Download Protein FASTA

411 aa · LXL04_029363|LXL04_029363|OH1004|PROTEIN

MYHAFNLFGWCTLYAYQCMIEKASQWLCVILVCLLQVLETYGFYVDITYLESAVEKGAVCLDGSPPAYHWDMGYDTGMDNWLVHIEGGGWCNNVTTCLDRTKTRLGSSKQMAEQVAFSGILHNEQQYNSDFYNWNKIKVRYCDGASFTGDVEKVNPKTNLHFRGARIFHAVIDDLLAKGMSNAENAILSGCSAGGLTSILHCDKFKSLLPKTTNVKCLSDAGYFINSQDVSGKRRLEAFYDDVVKTHGSAKHLPRSCTSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029363`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029363

Location Chr06:88370869-88373170 (-)

Description Similar to PAE8: Pectin acetylesterase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19420`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	Identification and functional characterization of the distinct plant pectin esterases PAE8 and PAE9 and their deletion mutants.2014 · DOI: 10.1007/s00425-014-2139-6
`At4g19410`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At5g45280`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At5g26670`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release
`At3g05910`	Hydrolyzes acetyl esters in homogalacturonan regions of pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029363 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009625 response to insect Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0052793 pectin acetylesterase activity Molecular Function

KEGG gene cross-reference

ath:AT3G05910

ath:AT4G19410

ath:AT4G19420

ath:AT5G26670

ath:AT5G45280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.450

Rank 1 · LXL04_029363 · OH-1004

Extracellular0.287

Rank 2 · LXL04_029363 · OH-1004

Cytoplasm0.127

Rank 3 · LXL04_029363 · OH-1004

Cell membrane0.115

Rank 4 · LXL04_029363 · OH-1004

Golgi apparatus0.109

Rank 5 · LXL04_029363 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03283.20PAE42-406 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029363	`PF03283.20`	PAE	42	406	2.3e-170	567.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6DBP4`	Arabidopsis thaliana	Pectin acetylesterase 8	62.982%	Swiss-Prot	strong database homology
`Q940J8`	Arabidopsis thaliana	Pectin acetylesterase 7	57.641%	Swiss-Prot	strong database homology
`Q9FH82`	Arabidopsis thaliana	Pectin acetylesterase 11	55.733%	Swiss-Prot	strong database homology
`Q66GM8`	Arabidopsis thaliana	Pectin acetylesterase 10	50.820%	Swiss-Prot	strong database homology
`Q9SFF6`	Arabidopsis thaliana	Pectin acetylesterase 12	50.273%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card