LXL04_028803 | RubberDandelionOmics

Gene overview

LXL04_028803

Reference: OH-1004 Chr: Chr06 Coordinates: 65298352-65305391 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1411 bp · LXL04_028803|LXL04_028803|OH1004|cDNA

ATGTCTGCCCCACCACAACCGCATATAACTTCTGTATCTTCTAAACCTGTATCTGGGATCTCGCGGAAACACCGGCAAGATGGTGTTGCCTTCGGTAACAGCGTCGGCGTAAGATCTCGGGCTGCGGTGCAGGATGTGGAGGCACGGGCTGTGGTCCCAGCTGTGGAGGAGCAGGCTGCTGTCCCGGATGTACGGGTGCAGGATGTGGAACCGGTAGCAGCTCGAGCGGTTGTTCCGGTTGTAGAGGCCCGGGTCGCCCG...

CDS

Download CDS FASTA

1371 bp · LXL04_028803|LXL04_028803|OH1004|CDS

ATGTCTGCCCCACCACAACCGCATATAACTTCTGTATCTTCTAAACCTGTATCTGGGATCTCGCGGAAACACCGGCAAGATGGTGTTGCCTTCGGTAACAGCGTCGGCGTAAGATCTCGGGCTGCGGTGCAGGATGTGGAGGCACGGGCTGTGGTCCCAGCTGTGGAGGAGCAGGCTGCTGTCCCGGATGTACGGGTGCAGGATGTGGAACCGGTAGCAGCTCGAGCGGTTGTTCCGGTTGTAGAGGCCCGGGTCGCCCG...

Protein

Download Protein FASTA

456 aa · LXL04_028803|LXL04_028803|OH1004|PROTEIN

MSAPPQPHITSVSSKPVSGISRKHRQDGVAFGNSVGVRSRAAVQDVEARAVVPAVEEQAAVPDVRVQDVEPVAARAVVPVVEARVARSDAIRRLQLLCRMFKSLALEPMDVDPIMAVFSAGPVGVSCFSNCCLKQLIRINNPSIVMNVALILWRNNETVCNQGQLWNKVEDDVVSNRLVYWRWVLKWRFHVKSLWQQIAVYTLKLILRWVVDPNELLKTAIAKAGYSEKIVIGMDVAASEFYAEKGKTYDLNFKEVLIRY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028803`
TK1151 ID	TkA01G241330
OH-1004 ID	LXL04_028803
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.500
Protein coverage (%)	TK1151 92.766 / OH-1004 94.956 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028803

Location Chr06:65298352-65305391 (+)

Description Similar to ENO1: Enolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36530`	Multifunctional enzyme that acts as an enolase involved in the metabolism and as a positive regulator of cold-responsive gene transcription.	LOS2, a genetic locus required for cold-responsive gene transcription encodes a bi-functional enolase.2002 · DOI: 10.1093/emboj/21.11.2692 Quantitative proteomics of the tonoplast reveals a role for glycolytic enzymes in salt tolerance.2009 · DOI: 10.1105/tpc.109.069211

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0167300`	Enolase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028803 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

KEGG gene cross-reference

ath:AT2G36530

dosa:Os10g0167300

zma:542316

zma:732811

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.467

Rank 1 · LXL04_028803 · OH-1004

Cytoplasm0.388

Rank 2 · LXL04_028803 · OH-1004

Mitochondrion0.121

Rank 3 · LXL04_028803 · OH-1004

Cell membrane0.072

Rank 4 · LXL04_028803 · OH-1004

Endoplasmic reticulum0.042

Rank 5 · LXL04_028803 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00113.29Enolase_C215-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028803	`PF00113.29`	Enolase_C	215	255	3.5e-11	43.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P25696`	Arabidopsis thaliana	Bifunctional enolase 2/transcriptional activator	82.927%	Swiss-Prot	weak database homology
`Q42971`	Oryza sativa subsp. japonica	Enolase	82.927%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card