RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_027924
Reference: OH-1004 Chr: Chr06 Coordinates: 26673287-26676538 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2124 bp · LXL04_027924|LXL04_027924|OH1004|cDNA

ATGGGTGGCAAGATGGTAACCATCATAGCCATTACAACCTACCTatctttctactccatttcaCCCCCACCAAAATCCCACTACCACTCCCTCTTCCTATCCACGTCACTCTCCGACAACACCTCCATATCAAACCACCTCTTCACCCTCACCCGCCGCCCCCACCTCGCCGGAACTCAAGTCAACGAAGAAGCCGCCACCTACGTCCTATCAACTCTCTCATCTAACAACATCAAATCACACCTATCGGAATACGAGGT...

CDS

Download CDS FASTA

2124 bp · LXL04_027924|LXL04_027924|OH1004|CDS

ATGGGTGGCAAGATGGTAACCATCATAGCCATTACAACCTACCTATCTTTCTACTCCATTTCACCCCCACCAAAATCCCACTACCACTCCCTCTTCCTATCCACGTCACTCTCCGACAACACCTCCATATCAAACCACCTCTTCACCCTCACCCGCCGCCCCCACCTCGCCGGAACTCAAGTCAACGAAGAAGCCGCCACCTACGTCCTATCAACTCTCTCATCTAACAACATCAAATCACACCTATCGGAATACGAGGT...

Protein

Download Protein FASTA

707 aa · LXL04_027924|LXL04_027924|OH1004|PROTEIN

MGGKMVTIIAITTYLSFYSISPPPKSHYHSLFLSTSLSDNTSISNHLFTLTRRPHLAGTQVNEEAATYVLSTLSSNNIKSHLSEYEVLLTYPDSRSLTLTRPAPDPLVTFTLSQETYDGDPYADVADQVEPTFHAYAKSGTVKGHVAYVNYGRVEDYKTIEDLGINLTGAIVVARYGEIYRGDIVENAYHAGAIGVLIYTDRKDYGGGGGGWFPEEKWMPPSGVQVGTVFNGAGDPSTPGWPSSVEGCERLSEDDVEKGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_027924
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_027924
LocationChr06:26673287-26676538 (-)
DescriptionSimilar to LAMP1: Probable glutamate carboxypeptidase LAMP1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g19740 Acts in association with AMP1 to suppress ectopic stem cell niche formation in the shoot apical meristem (SAM) independently of cytokinin signaling pathway. No verified direct reference in this release
At3g54720 May modulate the level of one or more small signaling molecules that have a role in regulating meristem function.
A comparative analysis of the Arabidopsis mutant amp1-1 and a novel weak amp1 allele reveals new functions of the AMP1 protein.2007 · DOI: 10.1007/s00425-006-0395-9
AMP1 and MP antagonistically regulate embryo and meristem development in Arabidopsis.2007 · DOI: 10.1242/dev.006759
ALTERED MERISTEM PROGRAM 1 is involved in development of seed dormancy in Arabidopsis.2011 · DOI: 10.1371/journal.pone.0020408
Arabidopsis ALTERED MERISTEM PROGRAM 1 negatively modulates plant responses to abscisic acid and dehydration stress.2013 · DOI: 10.1016/j.plaphy.2013.03.016
The glutamate carboxypeptidase AMP1 mediates abscisic acid and abiotic stress responses in Arabidopsis.2013 · DOI: 10.1111/nph.12275
ALTERED MERISTEM PROGRAM1 has conflicting effects on the tolerance to heat shock and symptom development after Pseudomonas syringae infection.2016 · DOI: 10.1016/j.bbrc.2016.10.025

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0790600 Involved in the regular timing (plastochron) of lateral organs formation.
PLASTOCHRON3/GOLIATH encodes a glutamate carboxypeptidase required for proper development in rice.2009 · DOI: 10.1111/j.1365-313x.2009.03841.x
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027924 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006508 proteolysis Biological Process
GO:0009640 photomorphogenesis Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0009908 flower development Biological Process
GO:0010073 meristem maintenance Biological Process
GO:0010074 maintenance of meristem identity Biological Process
GO:0010075 regulation of meristem growth Biological Process
GO:0010080 regulation of floral meristem growth Biological Process
GO:0010081 regulation of inflorescence meristem growth Biological Process
GO:0010082 regulation of root meristem growth Biological Process
GO:0010305 leaf vascular tissue pattern formation Biological Process
GO:0048364 root development Biological Process
KEGG gene cross-reference
ath:AT3G54720
ath:AT5G19740
dosa:Os03g0790600
hsa:10003
zma:100147738
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.516
Rank 1 · LXL04_027924 · OH-1004
Extracellular0.185
Rank 2 · LXL04_027924 · OH-1004
Endoplasmic reticulum0.149
Rank 3 · LXL04_027924 · OH-1004
Cytoplasm0.118
Rank 4 · LXL04_027924 · OH-1004
Cell membrane0.063
Rank 5 · LXL04_027924 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02225.28PA146-225 aa
PF04389.23Peptidase_M28324-512 aa
PF04253.21TFR_dimer575-702 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_027924PF02225.28PA1462256.1e-0833.4
LXL04_027924PF04389.23Peptidase_M283245121.1e-2488.0
LXL04_027924PF04253.21TFR_dimer5757021.8e-34119.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q7Y228Arabidopsis thalianaProbable glutamate carboxypeptidase LAMP164.088%Swiss-Protstrong database homology
Q9M1S8Arabidopsis thalianaProbable glutamate carboxypeptidase AMP141.365%Swiss-Protmoderate database homology
Q852M4Oryza sativa subsp. japonicaProbable glutamate carboxypeptidase PLA342.398%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser