LXL04_027914 | RubberDandelionOmics

Gene overview

LXL04_027914

Reference: OH-1004 Chr: Chr06 Coordinates: 26454859-26459099 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1869 bp · LXL04_027914|LXL04_027914|OH1004|cDNA

ATGGAGGAACAGAGTATAAAAACTCCATTTTTGAAACCTGCAGAAGATTGCAAAAACAGGAAGAGATGGAGAACAGCTATTTGGCTCTTCATTTCACTCACAGCTTTAATTTTTATCTCCCTGACATTGAGTCTAGAACTAGAAGATTGGAAGAAGCATAACAATGGAAAAGGAAATAAAGCAAGCAATAAGGTACAATCAGGCGATGAAGTCGAGTCATGGAAAGCGGTTGTTGCAGCCGATGATGCTCGTTGCTCGGA...

CDS

Download CDS FASTA

1869 bp · LXL04_027914|LXL04_027914|OH1004|CDS

ATGGAGGAACAGAGTATAAAAACTCCATTTTTGAAACCTGCAGAAGATTGCAAAAACAGGAAGAGATGGAGAACAGCTATTTGGCTCTTCATTTCACTCACAGCTTTAATTTTTATCTCCCTGACATTGAGTCTAGAACTAGAAGATTGGAAGAAGCATAACAATGGAAAAGGAAATAAAGCAAGCAATAAGGTACAATCAGGCGATGAAGTCGAGTCATGGAAAGCGGTTGTTGCAGCCGATGATGCTCGTTGCTCGGA...

Protein

Download Protein FASTA

622 aa · LXL04_027914|LXL04_027914|OH1004|PROTEIN

MEEQSIKTPFLKPAEDCKNRKRWRTAIWLFISLTALIFISLTLSLELEDWKKHNNGKGNKASNKVQSGDEVESWKAVVAADDARCSEIGASILNDGGHAVDAAVAVASCGGVVNPMASGIGGGGFMVVRSSDTSETLAFDFRESAPAAASQNMYANNINNKYSGPLSMGVPGELAGLHKAWSKYGRLPWKSLFQPAIHLAKHGFQVAPYLANSISSSSASIKKDPGLQAVFAPGGKILKAGDTCYNVKLGLSLEAIAEGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027914`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027914

Location Chr06:26454859-26459099 (+)

Description Similar to GGT3: Glutathione hydrolase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29210`	May play a role in protecting plants from some xenobiotic chemicals by degrading vacuolar glutathione conjugates into cysteine conjugates.	Glutathione conjugates in the vacuole are degraded by gamma-glutamyl transpeptidase GGT3 in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2006.03005.x
`At4g39640`	May play a role in preventing oxidative stress by metabolizing extracellular oxidized glutathione (GSSG).	No verified direct reference in this release
`At4g39650`	May be required for glutathione transport into developing seeds.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027914 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002682 regulation of immune system process Biological Process

GO:0006508 proteolysis Biological Process

GO:0006520 amino acid metabolic process Biological Process

GO:0006536 glutamate metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006691 leukotriene metabolic process Biological Process

GO:0006749 glutathione metabolic process Biological Process

GO:0006750 glutathione biosynthetic process Biological Process

GO:0006751 glutathione catabolic process Biological Process

GO:0006805 xenobiotic metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007283 spermatogenesis Biological Process

KEGG gene cross-reference

ath:AT4G29210

ath:AT4G39640

ath:AT4G39650

mmu:14598

rno:116568

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.418

Rank 1 · LXL04_027914 · OH-1004

Cell membrane0.185

Rank 2 · LXL04_027914 · OH-1004

Extracellular0.176

Rank 3 · LXL04_027914 · OH-1004

Cytoplasm0.176

Rank 4 · LXL04_027914 · OH-1004

Endoplasmic reticulum0.127

Rank 5 · LXL04_027914 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01019.28G_glu_transpept85-621 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027914	`PF01019.28`	G_glu_transpept	85	621	5.4e-175	583.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0G0`	Arabidopsis thaliana	Glutathione hydrolase 3	62.832%	Swiss-Prot	strong database homology
`Q8VYW6`	Arabidopsis thaliana	Glutathione hydrolase 1	49.113%	Swiss-Prot	moderate database homology
`Q680I5`	Arabidopsis thaliana	Glutathione hydrolase 2	48.067%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card