RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_027482
Reference: OH-1004 Chr: Chr06 Coordinates: 16959352-16963502 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2199 bp · LXL04_027482|LXL04_027482|OH1004|cDNA

ATGTCGTTTTCAGCCAACACCAACTTGCTCGGGTGCTTCCGGTTTAATGATTTCCCAACCGGAAAAACCACCGGATTATTATACTCCGGCGATCTCCTCCCGTCTCTCGGAGCCAATTTTAACCGCTCGGTTTCTCTAAATAAATACGTCGTTTCCCCGTTTGATAGACGTTACAGGGTGTGGGAGATGTTTCTGATTATTTTGGTGGTTTACTCGGCTTGGATTTCGCCATTTGACTTTGCGTTTCTTGATGAAAGAGA...

CDS

Download CDS FASTA

2199 bp · LXL04_027482|LXL04_027482|OH1004|CDS

ATGTCGTTTTCAGCCAACACCAACTTGCTCGGGTGCTTCCGGTTTAATGATTTCCCAACCGGAAAAACCACCGGATTATTATACTCCGGCGATCTCCTCCCGTCTCTCGGAGCCAATTTTAACCGCTCGGTTTCTCTAAATAAATACGTCGTTTCCCCGTTTGATAGACGTTACAGGGTGTGGGAGATGTTTCTGATTATTTTGGTGGTTTACTCGGCTTGGATTTCGCCATTTGACTTTGCGTTTCTTGATGAAAGAGA...

Protein

Download Protein FASTA

732 aa · LXL04_027482|LXL04_027482|OH1004|PROTEIN

MSFSANTNLLGCFRFNDFPTGKTTGLLYSGDLLPSLGANFNRSVSLNKYVVSPFDRRYRVWEMFLIILVVYSAWISPFDFAFLDEREGILRIYDNIVNGFFAIDIVLTFFVAYLDSQAYVLVDDHKKIALRYLSTWFIFDVSSTVPFRSLSLLCTDRRSVMGFQVLSMLRLWRLRRVSSLFARLEKDIRFNYFWIRCTKLISVTLFAVHCAGCFNYLIADRYPDPKNTWIGAVDPNFKTDSIWNRYVTSLYWSIVTLTTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_027482
TK1151 IDTkA07G061290
OH-1004 IDLXL04_027482
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.200
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_027482
LocationChr06:16959352-16963502 (+)
DescriptionSimilar to KAT1: Potassium channel KAT1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g46240 Highly selective inward-rectifying potassium channel. No verified direct reference in this release
At4g18290 Highly selective inward-rectifying potassium channel. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0245800 Probable inward-rectifying potassium channel. No verified direct reference in this release
Os01g0648000 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots.
Rice K+ uptake channel OsAKT1 is sensitive to salt stress.2005 · DOI: 10.1007/s00425-004-1437-9
UniProt: P0C550 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027482 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0007623 circadian rhythm Biological Process
GO:0009644 response to high light intensity Biological Process
GO:0010118 stomatal movement Biological Process
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0034702 monoatomic ion channel complex Cellular Component
GO:0005242 inward rectifier potassium channel activity Molecular Function
GO:0005249 voltage-gated potassium channel activity Molecular Function
GO:0042802 identical protein binding Molecular Function
KEGG gene cross-reference
ath:AT4G18290
ath:AT5G46240
dosa:Os01g0648000
dosa:Os02g0245800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.531
Rank 1 · LXL04_027482 · OH-1004
Cytoplasm0.194
Rank 2 · LXL04_027482 · OH-1004
Lysosome / Vacuole0.149
Rank 3 · LXL04_027482 · OH-1004
Endoplasmic reticulum0.144
Rank 4 · LXL04_027482 · OH-1004
Golgi apparatus0.092
Rank 5 · LXL04_027482 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520.38Ion_trans58-304 aa
PF07885.23Ion_trans_2242-298 aa
PF00027.36cNMP_binding395-481 aa
PF12796.14Ank_2540-605 aa
PF13857.13Ank_5541-585 aa
PF13637.13Ank_4541-569 aa
PF13606.13Ank_3548-576 aa
PF00023.37Ank549-579 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_027482PF00520.38Ion_trans583041e-42146.7
LXL04_027482PF07885.23Ion_trans_22422981.1e-1248.4
LXL04_027482PF00027.36cNMP_binding3954812.5e-1763.3
LXL04_027482PF12796.14Ank_25406052.1e-1248.2
LXL04_027482PF13857.13Ank_55415858.8e-1142.6
LXL04_027482PF13637.13Ank_45415696e-0936.7
LXL04_027482PF13606.13Ank_35485761.6e-0628.6
LXL04_027482PF00023.37Ank5495791.5e-1041.4
LXL04_027482PF13637.13Ank_45536006e-0936.7
LXL04_027482PF11834.14KHA6517181.1e-2177.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q39128Arabidopsis thalianaPotassium channel KAT156.148%Swiss-Protstrong database homology
Q38849Arabidopsis thalianaPotassium channel KAT255.389%Swiss-Protstrong database homology
Q6K3T2Oryza sativa subsp. japonicaPotassium channel KAT149.862%Swiss-Protmoderate database homology
Q0JKV1Oryza sativa subsp. japonicaPotassium channel AKT153.885%Swiss-Protstrong database homology
P0C550Oryza sativa subsp. indicaPotassium channel AKT153.885%Swiss-Protstrong database homology

JBrowse

View in Genome Browser